Property Summary

NCBI Gene PubMed Count 46
PubMed Score 125.26
PubTator Score 435.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma, large-cell 1.200 1.9e-04
osteosarcoma 1.175 6.3e-04
pancreatic cancer -1.500 1.5e-03
pancreatic ductal adenocarcinoma liver m... -2.674 2.5e-02
psoriasis -1.700 2.7e-25

Protein-protein Interaction (3)

Gene RIF (28)

AA Sequence

MNGPVDGLCDHSLSEGVFMFTSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE      1 - 70
ITSMAMVDYQRVVRDTIKHIGYDDSAKGFDFKTCNVLVALEQQSPDIAQCVHLDRNEEDVGAGDQGLMFG     71 - 140
YATDETEECMPLTIILAHKLNARMADLRRSGLLPWLRPDSKTQVTVQYMQDNGAVIPVRIHTIVISVQHN    141 - 210
EDITLEEMRRALKEQVIRAVVPAKYLDEDTVYHLQPSGRFVIGGPQGDAGVTGRKIIVDTYGGWGAHGGG    211 - 280
AFSGKDYTKVDRSAAYAARWVAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH    281 - 350
KNFDLRPGVIVRDLDLKKPIYQKTACYGHFGRSEFPWEVPRKLVF                             351 - 395
//

Text Mined References (48)

PMID Year Title