Property Summary

NCBI Gene PubMed Count 41
Grant Count 99
R01 Count 82
Funding $9,187,584.88
PubMed Score 120.78
PubTator Score 435.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.175 0.001
medulloblastoma, large-cell 1.200 0.000
pancreatic ductal adenocarcinoma liver m... -2.674 0.025
pancreatic cancer -1.500 0.001
psoriasis -1.700 0.000

Synonym

Accession Q00266 D3DWD5 Q5QP09 AdoMet synthase 1
Symbols MAT
SAMS
MATA1
SAMS1

Gene

PANTHER Protein Class (2)

PDB

2OBV  

Gene RIF (24)

PMID Text
24377546 5-Aza-CdR showed no effects on MAT2A methylation.
24231718 The mutations in the other 10 patients showed autosomal recessive inheritance and included eight novel MAT1A mutations.
23425511 Liver-specific isoenzyme MAT1A is genetically linked with an inborn metabolic disorder of hypermethioninemia, as well as a ubiquitously expressed isoenzyme MAT2A, whose enzymatic activity is regulated by an associated subunit MAT2B.
23241961 upregulation of miR-664, miR-485-3p, and miR-495 contributes to lower MAT1A expression in HCC, and enhanced tumorigenesis may provide potential targets for HCC therapy.
22951388 Methionine adenosyltransferase I/III deficiency is caused by mutations in the MAT1A gene. (Review)
22807109 Report SNPs that are highly associated with hepatic GNMT protein expression and the coordinate regulation of MAT1A levels.
22318685 we found for the first time a post-transcriptional regulation of MAT1A and MAT2A by AUF1 and HuR in hepatocellular carcinoma.
22270009 Human Dead-box protein 3 (DDX3X), a RNA helicase regulating RNA splicing, export, transcription and translation was down-regulated upon MAT1A expression.
21813468 Coexpression of MAT2A and MAT2B in COS-1 cells resulted in significantly increased MAT enzyme activity.
21678410 Methylation of the MAT1A coding region can inhibit gene transcription. This represents a key mechanism for decreased MAT1A expression in hepatocellular carcinoma.
More...

AA Sequence

MNGPVDGLCDHSLSEGVFMFTSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE      1 - 70
ITSMAMVDYQRVVRDTIKHIGYDDSAKGFDFKTCNVLVALEQQSPDIAQCVHLDRNEEDVGAGDQGLMFG     71 - 140
YATDETEECMPLTIILAHKLNARMADLRRSGLLPWLRPDSKTQVTVQYMQDNGAVIPVRIHTIVISVQHN    141 - 210
EDITLEEMRRALKEQVIRAVVPAKYLDEDTVYHLQPSGRFVIGGPQGDAGVTGRKIIVDTYGGWGAHGGG    211 - 280
AFSGKDYTKVDRSAAYAARWVAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH    281 - 350
KNFDLRPGVIVRDLDLKKPIYQKTACYGHFGRSEFPWEVPRKLVF                             351 - 395
//

Text Mined References (43)

PMID Year Title
24377546 2013 5-Aza-2<-deoxycytidine induces hepatoma cell apoptosis via enhancing methionine adenosyltransferase 1A expression and inducing S-adenosylmethionine production.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24231718 2013 Spectrum of mutations associated with methionine adenosyltransferase I/III deficiency among individuals identified during newborn screening in Japan.
23425511 2013 Insight into S-adenosylmethionine biosynthesis from the crystal structures of the human methionine adenosyltransferase catalytic and regulatory subunits.
23241961 2013 MicroRNAs regulate methionine adenosyltransferase 1A expression in hepatocellular carcinoma.
22951388 2012 Methionine adenosyltransferase I/III deficiency: neurological manifestations and relevance of S-adenosylmethionine.
22807109 2012 Human liver methionine cycle: MAT1A and GNMT gene resequencing, functional genomics, and hepatic genotype-phenotype correlation.
22318685 2012 Role of transcriptional and posttranscriptional regulation of methionine adenosyltransferases in liver cancer progression.
22270009 2012 Proteomic analysis of human hepatoma cells expressing methionine adenosyltransferase I/III: Characterization of DDX3X as a target of S-adenosylmethionine.
21813468 2011 Methionine adenosyltransferase 2A/2B and methylation: gene sequence variation and functional genomics.
More...