Property Summary

NCBI Gene PubMed Count 23
PubMed Score 36.29
PubTator Score 21.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.70899766054315E-9
tuberculosis and treatment for 6 months 686 3.3629391206584E-6
pediatric high grade glioma 2712 3.76474562516834E-5
ovarian cancer 8492 1.80526525610654E-4
psoriasis 6685 3.4555109731946E-4
glioblastoma 5572 9.70575985650353E-4
medulloblastoma, large-cell 6234 0.0100683468155355

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 1.200 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.100 0.001
medulloblastoma, large-cell -1.400 0.010
tuberculosis and treatment for 6 months -1.300 0.000
pediatric high grade glioma -1.100 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q00169 PI-TP-alpha
Symbols PITPN
VIB1A
HEL-S-36
PI-TPalpha

Gene

PANTHER Protein Class (1)

PDB

1UW5  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
17672918 the apparent occurrence of an unusual TG 3' splice site in intron 4 is discussed
15322105 the PITPalpha structure has to relax to allow access to the Ser166 site, and this may occur at the membrane surface where PI delivery is required for receptor-mediated PLC signaling

AA Sequence

MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPT      1 - 70
FVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVY     71 - 140
IDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVE    141 - 210
NFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD              211 - 270
//

Text Mined References (27)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22822086 2012 Phosphatidylinositol transfer protein, cytoplasmic 1 (PITPNC1) binds and transfers phosphatidic acid.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
More...