Property Summary

NCBI Gene PubMed Count 24
PubMed Score 36.29
PubTator Score 21.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.7e-09
glioblastoma -1.100 9.7e-04
medulloblastoma, large-cell -1.400 1.0e-02
ovarian cancer 1.100 1.0e-02
pediatric high grade glioma -1.100 3.8e-05
psoriasis 1.200 3.5e-04
tuberculosis and treatment for 3 months -1.100 1.3e-05

Synonym

Accession Q00169 PI-TP-alpha
Symbols PITPN
VIB1A
HEL-S-36
PI-TPalpha

Gene

PDB

1UW5  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPT      1 - 70
FVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVY     71 - 140
IDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVE    141 - 210
NFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD              211 - 270
//

Text Mined References (28)

PMID Year Title