Property Summary

NCBI Gene PubMed Count 145
PubMed Score 499.41
PubTator Score 351.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
group 3 medulloblastoma 1.400 2.0e-02
intraductal papillary-mucinous neoplasm ... 1.200 3.8e-02
lung cancer 1.600 1.5e-04
malignant mesothelioma 1.500 2.3e-06
medulloblastoma, large-cell 2.300 3.6e-05
Multiple myeloma 1.474 4.7e-03
nasopharyngeal carcinoma 1.100 4.7e-03
osteosarcoma -1.688 4.7e-04
ovarian cancer 1.300 3.9e-04
Rheumatoid arthritis 1.200 4.7e-02

Gene RIF (110)

AA Sequence

MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKA      1 - 70
QNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKR     71 - 140
KAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETR    141 - 210
YHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC                                      211 - 246
//

Text Mined References (153)

PMID Year Title