Property Summary

NCBI Gene PubMed Count 134
Grant Count 77
R01 Count 39
Funding $8,876,228.48
PubMed Score 457.70
PubTator Score 351.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.047
Multiple myeloma 1.474 0.005
malignant mesothelioma 1.500 0.000
osteosarcoma -1.688 0.000
group 4 medulloblastoma 2.300 0.000
medulloblastoma, large-cell 2.300 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.038
lung cancer 1.800 0.000
nasopharyngeal carcinoma 1.100 0.005
ovarian cancer 1.300 0.000

Synonym

Accession Q00059 A8MRB2 A9QXC6 B5BU05 Q5U0C6 mtTFA
Symbols TCF6
MTTF1
MTTFA
TCF6L1
TCF6L2
TCF6L3
MTDPS15

Gene

PDB

3FGH   3TMM   3TQ6   4NNU   4NOD  

Gene RIF (99)

PMID Text
26893822 Report failed upregulation of TFAM protein and mitochondrial DNA in oxidatively deficient fibers in skeletal muscle of chronic obstructive pulmonary disease patients.
26797282 our results revealed that stimulation of mitochondrial biogenesis by carvedilol resulted in functional gain of the mitochondria by showing increased oxygen consumption and mitochondrial respiratory rate.
26445116 Results showed that TFAM formed oligomers in mitochondria by in situ chemical cross-linking and suggested the importance of the dimerization of TFAM molecules in the distribution of mtDNA in cells.
26307971 Data show that mtTFA proteins are highly expressed in cancer and drug-resistant cells compared to normal cells, and the mtTFA expression is upregulated by signals of oxidative and DNA damage stress in cancer cells. [review]
25822152 TFAM overexpression suppressed mitoROS and their upregulation in rat cardiomyocytes.
25556274 indicating that miRNA-214 and MTFA may become important candidates for developing promising therapeutic strategies for the treatment of cervical cancer
25243473 expression of PGC1alpha and TFAM varies between ovarian carcinoma subtypes; clear-cell carcinoma consists of undetectability of PGC1alpha/TFAM, and low ERalpha/Ki-67. high-grade serous carcinomas had a converse state of PGC1alpha/TFAM, ERalpha positivity and high Ki-67 index
25108120 The combination of strong mtTFA expression and a high survivin index may predict a poor prognosis in patients with pancreatic ductal adenocarcinoma
24875355 The mitochondria targeting sequence-deficient hTFAM also repressed Tfam promoter activity to the same degree as hTFAM.
24837562 Methylation of TFAM promoters changed 2 days after gastric bypass.
More...

AA Sequence

MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKA      1 - 70
QNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKR     71 - 140
KAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETR    141 - 210
YHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC                                      211 - 246
//

Text Mined References (142)

PMID Year Title
26893822 2016 Failed upregulation of TFAM protein and mitochondrial DNA in oxidatively deficient fibers of chronic obstructive pulmonary disease locomotor muscle.
26797282 2016 Carvedilol promotes mitochondrial biogenesis by regulating the PGC-1/TFAM pathway in human umbilical vein endothelial cells (HUVECs).
26445116 2015 Interaction of human mitochondrial transcription factor A in mitochondria: its involvement in the dynamics of mitochondrial DNA nucleoids.
26307971 2015 Mitochondrial Transcription Factor A and Mitochondrial Genome as Molecular Targets for Cisplatin-Based Cancer Chemotherapy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25822152 2015 Overexpression of TFAM or twinkle increases mtDNA copy number and facilitates cardioprotection associated with limited mitochondrial oxidative stress.
25556274 2014 The inhibitory role of miR-214 in cervical cancer cells through directly targeting mitochondrial transcription factor A (TFAM).
25416956 2014 A proteome-scale map of the human interactome network.
25243473 2014 Expression of mitochondrial regulators PGC1? and TFAM as putative markers of subtype and chemoresistance in epithelial ovarian carcinoma.
25108120 2015 The combination of strong immunohistochemical mtTFA expression and a high survivin index predicts a shorter disease-specific survival in pancreatic ductal adenocarcinoma.
More...