Property Summary

NCBI Gene PubMed Count 31
PubMed Score 35.97
PubTator Score 30.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (14)

AA Sequence

MTMSSFLINSNYIEPKFPPFEEYAQHSGSGGADGGPGGGPGYQQPPAPPTQHLPLQQPQLPHAGGGREPT      1 - 70
ASYYAPRTAREPAYPAAALYPAHGAADTAYPYGYRGGASPGRPPQPEQPPAQAKGPAHGLHASHVLQPQL     71 - 140
PPPLQPRAVPPAAPRRCEAAPATPGVPAGGSAPACPLLLADKSPLGLKGKEPVVYPWMKKIHVSAVNPSY    141 - 210
NGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTK    211 - 280
MRSSNSASASAGPPGKAQTQSPHLHPHPHPSTSTPVPSSI                                  281 - 320
//

Text Mined References (33)

PMID Year Title