Property Summary

NCBI Gene PubMed Count 30
PubMed Score 34.23
PubTator Score 30.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Hypospadias 65
Disease Target Count Z-score Confidence
Sertoli cell tumor 9 3.016 1.5

Expression

Synonym

Accession Q00056 A4D180 O43366
Symbols HOX1
HOX1D

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG

Gene RIF (13)

PMID Text
26166023 HOXA4 increases short-term repopulation to higher levels than HOXB4, which may involve Notch signaling to induce self-renewal of primitive hematopoietic cells
25585874 The NK AML patients with NPM1 mutations exhibited elevated HOXA4 methylation and expression levels of HOXA5 and MEIS1 compared with the NPM1 wildtype patients.
25472883 HIV-1 Tat specifically associates with HOXA4 promoter to upregulate HOXA4 expression in T cells
23484077 promoter hypermethylation of HOXA4 gene could be an epigenetic mechanism mediating IM resistance in CML patients.
21627813 HOXA4 showed nuclear & perinuclear staining in endothelial & smooth muscle cells in aorta. Spatial variation in expression in human aortas persisted into adulthood. Downregulation of HOXA4 expression was associated with abdominal aortic aneurysm.
21546695 Studies suggest that HOXA4, HOXA5 and HOXB4 provide the spatial information needed to restrict the response to signals from the notochord, and not up regulated in pancreatic cancer.
19723874 Results confirm that HOXA4 inhibits cell motility, show that it suppresses cell spreading and filopodia formation while enhancing cell-cell adhesion, and suggest a role for beta1 integrin in mediating these changes.
19563517 combination of low HOXA4 and low MEIS1 gene expression is a favourable predictor for outcome in all AML patients and that the expression levels are governed by the methylation state of these genes.
19453261 Observational study of gene-disease association. (HuGE Navigator)
18410541 analysis of the role of deregulated PcG genes in acute myeloid leukemia, and the downstream PcG targets HOXA4, HOXA9 and MEIS1
More...

AA Sequence

MTMSSFLINSNYIEPKFPPFEEYAQHSGSGGADGGPGGGPGYQQPPAPPTQHLPLQQPQLPHAGGGREPT      1 - 70
ASYYAPRTAREPAYPAAALYPAHGAADTAYPYGYRGGASPGRPPQPEQPPAQAKGPAHGLHASHVLQPQL     71 - 140
PPPLQPRAVPPAAPRRCEAAPATPGVPAGGSAPACPLLLADKSPLGLKGKEPVVYPWMKKIHVSAVNPSY    141 - 210
NGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTK    211 - 280
MRSSNSASASAGPPGKAQTQSPHLHPHPHPSTSTPVPSSI                                  281 - 320
//

Text Mined References (32)

PMID Year Title
26166023 2015 HOXA4 provides stronger engraftment potential to short-term repopulating cells than HOXB4.
25585874 2015 Promoter DNA methylation and expression levels of HOXA4, HOXA5 and MEIS1 in acute myeloid leukemia.
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
23484077 2013 HOXA4 gene promoter hypermethylation as an epigenetic mechanism mediating resistance to imatinib mesylate in chronic myeloid leukemia patients.
21627813 2011 Regional expression of HOXA4 along the aorta and its potential role in human abdominal aortic aneurysms.
21546695 2011 HOX genes in pancreatic development and cancer.
19723874 2009 Cell motility and spreading are suppressed by HOXA4 in ovarian cancer cells: possible involvement of beta1 integrin.
19563517 2009 The combined expression of HOXA4 and MEIS1 is an independent prognostic factor in patients with AML.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
18410541 2008 Gene expression profiling of Polycomb, Hox and Meis genes in patients with acute myeloid leukaemia.
More...