Property Summary

NCBI Gene PubMed Count 76
PubMed Score 57.45
PubTator Score 42.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Spinocerebellar Ataxia 12 1 0.0 0.0
Spinocerebellar Ataxias 34 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 1.2
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (16)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -4.400 6.5e-09
Breast cancer -1.300 3.2e-38
colon cancer -1.200 4.0e-04
diabetes mellitus 1.200 1.9e-03
glioblastoma -1.300 4.8e-02
group 4 medulloblastoma -2.600 3.5e-05
interstitial cystitis -1.700 1.0e-02
intraductal papillary-mucinous carcinoma... -1.200 2.5e-04
lung carcinoma 1.200 3.7e-12
medulloblastoma, large-cell -1.300 2.2e-02
ovarian cancer -1.800 4.6e-04
pediatric high grade glioma -1.600 1.5e-03
Pick disease -1.200 2.3e-03
psoriasis -1.400 3.0e-04
tuberculosis 1.200 3.9e-04
type I diabetes mellitus -1.050 1.5e-02

Gene RIF (71)

AA Sequence

MEEDIDTRKINNSFLRDHSYATEADIISTVEFNHTGELLATGDKGGRVVIFQREQESKNQVHRRGEYNVY      1 - 70
STFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLR     71 - 140
DPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHINSISVNSDYETYMSADDLRINLWNFEITNQSFNI    141 - 210
VDIKPANMEELTEVITAAEFHPHHCNTFVYSSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSEI    211 - 280
ISSISDVKFSHSGRYIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSD    281 - 350
SVIMTGSYNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAW    351 - 420
HPSENIIAVAATNNLYIFQDKVN                                                   421 - 443
//

Text Mined References (77)

PMID Year Title