Property Summary

NCBI Gene PubMed Count 28
PubMed Score 145.31
PubTator Score 74.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Drug-Induced Liver Injury 118
Disease Target Count P-value
ovarian cancer 8491 5.3e-10
lung cancer 4473 8.2e-05
medulloblastoma, large-cell 6234 9.5e-05
adult high grade glioma 2148 8.0e-04
glioblastoma 5572 2.1e-03
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Liver disease 219 0.0 1.0
Disease Target Count Z-score Confidence
Oophoritis 9 4.007 2.0
Ectopic pregnancy 16 3.039 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma 1.200 2.1e-03
medulloblastoma, large-cell 1.400 9.5e-05
lung cancer -2.200 8.2e-05
adult high grade glioma 1.400 8.0e-04
ovarian cancer 1.100 5.3e-10

Gene RIF (7)

PMID Text
25737043 The data of this study link the finding of elevated serum PZP levels with the characteristic Alzheimer's Disease pathology and identify PZP as a novel component in Alzheimer's Disease.
21879768 Quantitative measurements using a multiple reaction monitoring assay showed a significant increase in plasma pregnancy-zone protein in presymptomatic Alzheimer disease compared with controls
20708005 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19105203 Observational study of gene-disease association. (HuGE Navigator)
17257854 A new purification methodology was used on the C-terminal peptide fragment of PZP.
11811950 Differential binding to ldl receptor related protein

AA Sequence

MRKDRLLHLCLVLLLILLSASDSNSTEPQYMVLVPSLLHTEAPKKGCVLLSHLNETVTVSASLESGRENR      1 - 70
SLFTDLVAEKDLFHCVSFTLPRISASSEVAFLSIQIKGPTQDFRKRNTVLVLNTQSLVFVQTDKPMYKPG     71 - 140
QTVRFRVVSVDENFRPRNELIPLIYLENPRRNRIAQWQSLKLEAGINQLSFPLSSEPIQGSYRVVVQTES    141 - 210
GGRIQHPFTVEEFVLPKFEVKVQVPKIISIMDEKVNITVCGEYTYGKPVPGLATVSLCRKLSRVLNCDKQ    211 - 280
EVCEEFSQQLNSNGCITQQVHTKMLQITNTGFEMKLRVEARIREEGTDLEVTANRISEITNIVSKLKFVK    281 - 350
VDSHFRQGIPFFAQVLLVDGKGVPIPNKLFFISVNDANYYSNATTNEQGLAQFSINTTSISVNKLFVRVF    351 - 420
TVHPNLCFHYSWVAEDHQGAQHTANRVFSLSGSYIHLEPVAGTLPCGHTETITAHYTLNRQAMGELSELS    421 - 490
FHYLIMAKGVIVRSGTHTLPVESGDMKGSFALSFPVESDVAPIARMFIFAILPDGEVVGDSEKFEIENCL    491 - 560
ANKVDLSFSPAQSPPASHAHLQVAAAPQSLCALRAVDQSVLLMKPEAELSVSSVYNLLTVKDLTNFPDNV    561 - 630
DQQEEEQGHCPRPFFIHNGAIYVPLSSNEADIYSFLKGMGLKVFTNSKIRKPKSCSVIPSVSAGAVGQGY    631 - 700
YGAGLGVVERPYVPQLGTYNVIPLNNEQSSGPVPETVRSYFPETWIWELVAVNSSGVAEVGVTVPDTITE    701 - 770
WKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEVFTLKATVLNYLPKCIRVSVQLKASPAF    771 - 840
LASQNTKGEESYCICGNERQTLSWTVTPKTLGNVNFSVSAEAMQSLELCGNEVVEVPEIKRKDTVIKTLL    841 - 910
VEAEGIEQEKTFSSMTCASGANVSEQLSLKLPSNVVKESARASFSVLGDILGSAMQNIQNLLQMPYGCGE    911 - 980
QNMVLFAPNIYVLNYLNETQQLTQEIKAKAVGYLITGYQRQLNYKHQDGSYSTFGERYGRNQGNTWLTAF    981 - 1050
VLKTFAQARSYIFIDEAHITQSLTWLSQMQKDNGCFRSSGSLLNNAIKGGVEDEATLSAYVTIALLEIPL   1051 - 1120
PVTNPIVRNALFCLESAWNVAKEGTHGSHVYTKALLAYAFSLLGKQNQNREILNSLDKEAVKEDNLVHWE   1121 - 1190
RPQRPKAPVGHLYQTQAPSAEVEMTSYVLLAYLTAQPAPTSGDLTSATNIVKWIMKQQNAQGGFSSTQDT   1191 - 1260
VVALHALSRYGAATFTRTEKTAQVTVQDSQTFSTNFQVDNNNLLLLQQISLPELPGEYVITVTGERCVYL   1261 - 1330
QTSMKYNILPEKEDSPFALKVQTVPQTCDGHKAHTSFQISLTISYTGNRPASNMVIVDVKMVSGFIPLKP   1331 - 1400
TVKMLERSSSVSRTEVSNNHVLIYVEQVTNQTLSFSFMVLQDIPVGDLKPAIVKVYDYYETDESVVAEYI   1401 - 1470
APCSTDTEHGNV                                                             1471 - 1482
//

Text Mined References (34)

PMID Year Title
25737043 2015 Pregnancy Zone Protein is Increased in the Alzheimer's Disease Brain and Associates with Senile Plaques.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
21879768 2011 Serum levels of pregnancy zone protein are elevated in presymptomatic Alzheimer's disease.
21362503 2011 Protein profile of exosomes from trabecular meshwork cells.
21269460 2011 Initial characterization of the human central proteome.
20708005 2010 Genome-wide association study identifies variants associated with histologic features of nonalcoholic Fatty liver disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19105203 2009 An association analysis of Alzheimer disease candidate genes detects an ancestral risk haplotype clade in ACE and putative multilocus association between ACE, A2M, and LRRTM3.
17257854 2007 Proteolytic hydrolysis and purification of the LRP/alfa-2-macroglobulin receptor domain from alpha-macroglobulins.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11811950 2002 Differential binding properties of human pregnancy zone protein- and alpha2-macroglobulin-proteinase complexes to low-density lipoprotein receptor-related protein.
9344465 1997 Interaction of matrix metalloproteinases-2 and -9 with pregnancy zone protein and alpha2-macroglobulin.
8662763 1996 Activated human plasma carboxypeptidase B is retained in the blood by binding to alpha2-macroglobulin and pregnancy zone protein.
8620037 1996 Preparation and characterization of a C-terminal fragment of pregnancy zone protein corresponding to the receptor-binding peptide from human alpha 2-macroglobulin.
7678727 1993 alpha-Macroglobulin domain structure studied by specific limited proteolysis.
7513640 1994 Binding of transforming growth factor-beta (TGF-beta) to pregnancy zone protein (PZP). Comparison to the TGF-beta-alpha 2-macroglobulin interaction.
6209714 1984 Partial primary structure of human pregnancy zone protein: extensive sequence homology with human alpha 2-macroglobulin.
2692707 1989 Pregnancy zone protein, a proteinase-binding macroglobulin. Interactions with proteinases and methylamine.
2478422 1989 A cluster of alpha 2-macroglobulin-related genes (alpha 2 M) on human chromosome 12p: cloning of the pregnancy-zone protein gene and an alpha 2M pseudogene.
2476433 1989 The alpha-macroglobulin bait region. Sequence diversity and localization of cleavage sites for proteinases in five mammalian alpha-macroglobulins.
2462561 1989 Human fibroblast collagenase-alpha-macroglobulin interactions. Localization of cleavage sites in the bait regions of five mammalian alpha-macroglobulins.
2415522 1985 Characterization of human pregnancy zone protein. Comparison with human alpha 2-macroglobulin.
1989698 1991 Primary structure of pregnancy zone protein. Molecular cloning of a full-length PZP cDNA clone by the polymerase chain reaction.
1702714 1990 Enzymatic activity of prostate-specific antigen and its reactions with extracellular serine proteinase inhibitors.
1692292 1990 A genetic polymorphism in a functional domain of human pregnancy zone protein: the bait region. Genomic structure of the bait domains of human pregnancy zone protein and alpha 2 macroglobulin.