Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.32
PubTator Score 2.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical carcinoma -1.062 9.5e-04
ductal carcinoma in situ -1.100 2.9e-04
osteosarcoma -1.431 3.5e-04
pancreatic ductal adenocarcinoma liver m... 1.284 5.2e-03

Gene RIF (1)

AA Sequence

MAASGRGLCKAVAASPFPAWRRDNTEARGGLKPEYDAVVIGAGHNGLVAAAYLQRLGVNTAVFERRHVIG      1 - 70
GAAVTEEIIPGFKFSRASYLLSLLRPQIYTDLELKKHGLRLHLRNPYSFTPMLEEGAGSKVPRCLLLGTD     71 - 140
MAENQKQIAQFSQKDAQVFPKYEEFMHRLALAIDPLLDAAPVDMAAFQHGSLLQRMRSLSTLKPLLKAGR    141 - 210
ILGAQLPRYYEVLTAPITKVLDQWFESEPLKATLATDAVIGAMTSPHTPGSGYVLLHHVMGGLEGMQGAW    211 - 280
GYVQGGMGALSDAIASSATTHGASIFTEKTVAKVQVNSEGCVQGVVLEDGTEVRSKMVLSNTSPQITFLK    281 - 350
LTPQEWLPEEFLERISQLDTRSPVTKINVAVDRLPSFLAAPNAPRGQPLPHHQCSIHLNCEDTLLLHQAF    351 - 420
EDAMDGLPSHRPVIELCIPSSLDPTLAPPGCHVVSLFTQYMPYTLAGGKAWDEQERDAYADRVFDCIEVY    421 - 490
APGFKDSVVGRDILTPPDLERIFGLPGGNIFHCAMSLDQLYFARPVPLHSGYRCPLQGLYLCGSGAHPGG    491 - 560
GVMGAAGRNAAHVAFRDLKSM                                                     561 - 581
//

Text Mined References (12)

PMID Year Title