Property Summary

NCBI Gene PubMed Count 8
PubMed Score 10.02
PubTator Score 4.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 9.3e-32
lung carcinoma 2844 2.2e-19
primary Sjogren syndrome 788 2.9e-04
cutaneous lupus erythematosus 1056 2.9e-03
interstitial cystitis 2299 3.9e-03
osteosarcoma 7933 6.2e-03
Disease Target Count Z-score Confidence
Asthma 349 0.0 2.0

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.500 2.9e-03
osteosarcoma -1.531 6.2e-03
interstitial cystitis 2.200 3.9e-03
primary Sjogren syndrome 2.100 2.9e-04
lung carcinoma -1.800 2.2e-19
psoriasis 1.300 9.3e-32

Synonym

Accession Q6K0P9 Q5T3W6 Q6K0P6 Q6K0P7 Q6K0P8 Q8WW65
Symbols IFIX

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

PMID Text
20595294 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18247378 IFIXalpha suppressed the invasion activity of MDA-MB-468 breast cancer cells, and its inhibitory effect was reversed by the knockdown of maspin
16479015 IFIX alpha1 isoform functions as a tumor suppressor by repressing HDM2 function
15122330 a new member of the hematopoietic interferon (IFN)-inducible nuclear protein. Six different alternatively spliced forms are transcribed from the IFIX gene

AA Sequence

MANNYKKIVLLKGLEVINDYHFRIVKSLLSNDLKLNPKMKEEYDKIQIADLMEEKFPGDAGLGKLIEFFK      1 - 70
EIPTLGDLAETLKREKLKVANKIESIPVKGIIPSKKTKQKEVYPATPACTPSNRLTAKGAEETLGPQKRK     71 - 140
KPSEEETGTKRSKMSKEQTRPSCSAGASTSTAMGRSPPPQTSSSAPPNTSSTESLKPLANRHATASKNIF    141 - 210
REDPIIAMVLNATKVFKYESSENEQRRMFHATVATQTQFFHVKVLNINLKRKFIKKRIIIISNYSKRNSL    211 - 280
LEVNEASSVSEAGPDQTFEVPKDIIRRAKKIPKINILHKQTSGYIVYGLFMLHTKIVNRKTTIYEIQDKT    281 - 350
GSMAVVGKGECHNIPCEKGDKLRLFCFRLRKRENMSKLMSEMHSFIQIQKNTNQRSHDSRSMALPQEQSQ    351 - 420
HPKPSEASTTLPESHLKTPQMPPTTPSSSSFTKKDETHPGAQSSPANFRITSPTVAPPLSSDTSTNRHPA    421 - 490
VP                                                                        491 - 492
//

Text Mined References (10)

PMID Year Title
21804549 2011 Meta-analysis of genome-wide association studies of asthma in ethnically diverse North American populations.
20595294 2010 Association of IFI200 gene polymorphisms with susceptibility to systemic lupus erythematosus.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18247378 2008 Interferon-inducible protein IFIXalpha inhibits cell invasion by upregulating the metastasis suppressor maspin.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16479015 2006 Interferon-inducible protein IFIXalpha1 functions as a negative regulator of HDM2.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15122330 2004 Antitumor activity of IFIX, a novel interferon-inducible HIN-200 gene, in breast cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.