Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.62
PubTator Score 3.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.514 5.6e-05
posterior fossa group B ependymoma 1.300 1.9e-08
medulloblastoma, large-cell 1.300 1.2e-04
tuberculosis and treatment for 6 months -1.100 7.3e-05
breast carcinoma 1.100 5.0e-03

Protein-protein Interaction (8)

Gene RIF (1)

PMID Text
25865492 Hypomyelination and the absence of lax caused by previously reported mutations in the gene encoding PYCR2's isozyme, PYCR1, suggesting a unique and indispensable role for PYCR2 in the human CNS during development.

AA Sequence

MSVGFIGAGQLAYALARGFTAAGILSAHKIIASSPEMNLPTVSALRKMGVNLTRSNKETVKHSDVLFLAV      1 - 70
KPHIIPFILDEIGADVQARHIVVSCAAGVTISSVEKKLMAFQPAPKVIRCMTNTPVVVQEGATVYATGTH     71 - 140
ALVEDGQLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAYAFMALDALADGGVKMGLPRRLAIQLGAQAL    141 - 210
LGAAKMLLDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRELQSMADQEKISPA    211 - 280
ALKKTLLDRVKLESPTVSTLTPSSPGKLLTRSLALGGKKD                                  281 - 320
//

Text Mined References (20)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25865492 2015 Mutations in PYCR2, Encoding Pyrroline-5-Carboxylate Reductase 2, Cause Microcephaly and Hypomyelination.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23024808 2012 Functional specialization in proline biosynthesis of melanoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
6894153 1981 Pyrroline-5-carboxylate reductase in human erythrocytes.
2722838 1989 Purified human erythrocyte pyrroline-5-carboxylate reductase. Preferential oxidation of NADPH.