Property Summary

NCBI Gene PubMed Count 114
PubMed Score 50.49
PubTator Score 657.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
nephrosclerosis 1.323 2.1e-04
Waldenstrons macroglobulinemia 1.075 3.0e-02
malignant mesothelioma -2.800 2.8e-07
psoriasis 2.300 1.9e-05
osteosarcoma -1.635 4.7e-03
glioblastoma 2.000 6.6e-04
tuberculosis 2.800 5.2e-09
primary pancreatic ductal adenocarcinoma 1.059 2.4e-02
intraductal papillary-mucinous carcinoma... 1.100 1.2e-02
lung cancer -1.300 2.5e-04
pancreatic cancer 1.100 4.1e-04
pediatric high grade glioma 1.200 1.3e-02
pilocytic astrocytoma 1.500 6.2e-07
subependymal giant cell astrocytoma 1.762 1.1e-02
invasive ductal carcinoma 1.113 3.2e-03
lung carcinoma -1.700 3.0e-22
Breast cancer 1.100 2.9e-03
ductal carcinoma in situ 1.200 1.9e-02
ovarian cancer 2.300 6.8e-06

 GWAS Trait (1)

Protein-protein Interaction (8)

Gene RIF (87)

PMID Text
26468282 ASC Induces Procaspase-8 Death Effector Domain Filaments
26457439 The proteins of NLRP3, ASC, and caspase-1 were observed in infiltrating inflammatory cells in cholesteatoma and chronic otitis media.
26093088 ASC/TMS1 methylation was significantly correlated with higher tumor nuclear grade. ASC/TMS1 is a novel functional tumor suppressor in renal carcinogenesis.
25567507 ASC interacts with NALP3 and caspase-1 via different domains.
25372293 caspase-1/ASC inflammasomes play a significant role in the activation of IL-1beta/ROS and NF-kappaB signaling of cytokine gene expression for T. cruzi control in human and mouse macrophages.
25205754 Neutralization of ASC improves sperm motility in men with spinal cord injuries.
25191796 The proteins (HSP90b, TSM1 and L-plastin) in the current study may hold potential in differentiating between melanoma and benign nevi in diagnostically challenging cases.
25061439 mRNA levels of Apoptosis-associated Speck-like protein were significantly higher in freshly isolated PBMCs from Chronic recurrent multifocal osteomyelitis patients in active disease than in healthy controls.
25011057 Transcriptome analysis of human adipocytes implicates the NOD-like receptor pathway (NLRP3, PYCARD) in obesity-induced adipose inflammation.
25006247 R42W mutation had a significant effect on structure and increased stability. Although the R42W mutant exhibited reduced interaction with ASC
24630722 Activated AIM2 and NLRP3 nucleate PYD filaments of ASC, which, in turn, cluster the CARD of ASC. ASC thus nucleates CARD filaments of caspase-1, leading to proximity-induced activation.studies revealed a universal assembly process for ASC-dependent inflammasomes in both ALR and NLR families that involves nucleation-induced polymerization.
24585381 ASC PYD prevented complex formation with NALP3 PYD in vitro
24469054 Data indicate that apoptosis-associated speck-like protein containing a caspase recruitment domain (ASC) is highly expressed in medulloblastomas.
24407287 this study reports an interaction between promyelocytic leukemia protein and apoptosis-associated speck-like protein containing a caspase-activating recruitment domain (ASC).
24169962 PYCARD methylation is associated with colon cancer.
24158569 Identify a novel innate immune signaling pathway (NLRP3-ASC-caspase-1-IL-1beta) activated by Ni(2+).
23839215 Study shows that T. gondii-induced IL-1beta production is dependent on the classical inflammasome components caspase-1 and ASC.Additionally, a role for a specific parasite factor, dense granule protein GRA15, in T. gondii induction of IL-1beta was demonstrated.
23811549 this study was to investigate the mRNA levels of AIM2 and ASC in a lymphocyte cell line (Jurkat) before and after MiR-143 introducing.
23110696 central role of CARDs in the formation of ASC signalling platforms
23090995 ASC in different tissues may influence tumor growth in opposite directions.
23066025 ASC PYD can simultaneously self-associate and interact with NLRP3, rationalizing the model whereby ASC self-association upon recruitment to NLRP3 promotes clustering and activation of procaspase-1.
23064206 Reactivation of ASC protein expression in LS174T cells promotes sodium butyrate induced apoptosis.
22934972 The findings of this work may suggest a crucial relationship between mutant MEFV/pyrin and remarkable ASC up-regulation in familial Mediterranean fever inflammation.
22931929 These findings suggest stage-dependent dual roles of ASC in melanoma tumorigenesis.
22732093 Gene expression profiles of ASC or CatB deficient human DCs show marked overlap with downregulation of genes implicated in DC function.
22295065 the requirement of TLR2/MyD88/NF-kappaB pathway (first signal) and ROS/potassium efflux (second signal) for NLRP3/ASC inflammasome formation, leading to caspase-1 activation and subsequent IL-1beta release during RSV infection
22230750 Hypermethylation of ASC is associated with cholangiocarcinoma.
21832064 Caspase-1 protein induces apoptosis-associated speck-like protein containing a caspase recruitment domain (ASC)-mediated necrosis independently of its catalytic activity.
21487011 a function for ASC that is distinct from the inflammasome in modulating MAPK activity and chemokine expression and further identify DUSP10 as a novel ASC target.
21270336 The inflammasome component apoptosis-associated speck-like protein containing a caspase recruitment domain (ASC), an adapter protein within the NLRP3 inflammasome, is a crucial element in the adjuvant effect of MF59 combined with H5N1 subunit vaccines.
21104989 Hypermethylation of TMS1 gene is associated with neuroblastoma.
21058222 The patients carried 11 different NLRP3 mutations and were classified as MWS(n = 6), CINCA (n = 4), FCAS (n = 1) and undefined CAPS (n = 3). INTERPRETATION: The incidence of CAPS in Germany is very low.
21036703 TMS1 expression was repressed in MIA PaCa-2 cells by DNA methylation. Upregulation of TMS1 by recombinant gene expression in MIA PaCa-2 cells or by pretreatment of cells with 5-azacytidine resulted in enhanced sensitivity to gemcitabine and docetaxel.
20926535 Our results demonstrated that the TMSI gene is methylated in thyroid cancer cells and repression of methylation by 5-aza-2'-deoxycytidine restored expression of the TMS1 gene and sensitized cells to TRAIL-induced apoptosis.
20808838 the role of NLRP3 (NALP3), its adaptor protein PYCARD (ASC), and caspase-1 during infection with Mycobacterium tuberculosis
20500518 ASC mediates distinct forms of cell death in different cell types, and is a promising target for cancer therapy.
20148899 The authors show that recognition of Mycobacterium tuberculosis infection by the NLRP3 inflammasome requires the activity of the bacterial virulence factor ESAT-6, and the subsequent IL-1beta response is regulated by NLR/CARD proteins such as ASC.
20140741 The result found significantly poor prognosis in event-free survival in cases with hypermethylation of TMS1 gene.
20020448 Report kinetic properties of ASC protein aggregation in epithelial cells.
19759850 Results suggest that although the PGR domain of ASC is dispensable for procaspase-1 activation, it plays an important role in the regulation of the molecular structure and activity of ASC.
19759015 analysis of interdomain dynamics of apoptosis-associated speck-like protein containing a CARD (ASC)
19661336 Methylation mediated silencing of TMS1 in breast cancer and is associated with docetaxel cytotoxicity.
19636848 Complete aromatic side chain assignments were obtained for all 6 Tyr residues in ASC, and for 2 out of the 5 Phe residues, and partial assignments are known for two more Phe residues.
19443857 Data show that the high sensitivity of MS-qFRET enables one-step detection of methylation at PYCARD, CDKN2B, and CDKN2A genes in patient sputum samples that contain low concentrations of methylated DNA, which normally would require a nested PCR approach.
19324871 The intronic DNase I-hypersensitive sites element acts in cis to maintain transcriptional competency at the TMS1 locus and that this activity is mediated by the ets transcription factor, GABPalpha.
19258216 The study conclude that the frequency of TMS1/ASC gene methylation in cervical cancer is rare and have no any critical role in development of cervical cancer.
19234215 Prevention of ASC cytosolic redistribution completely abolishes pathogen-induced inflammasome activity, which affirms that cytosolic localization of ASC is essential for inflammasome function.
19223547 TMS1 is selectively down-regulated in the aberrant epithelial cells filling the lumen of the breast duct in a subset of primary Ductal carcinoma in situ lesions.
19201894 P. gingivalis causes ASC- and NLRP3-dependent necrosis
18945969 PYCARD appeared to play a central role in a stromal/hematopoietic cell coculture-dependent induction of genes relevant to the activation of caspase signaling and apoptosis
18791131 ASC is expressed in renal glomeruli of patients with familial mediterranean fever. High local ASC expression results in speck formation and the specks from dying cells may persist in the extracellular space where they may nucleate amyloid.
18701507 Epigenetic silencing of TMS1 is associated with cancer
18348116 The pyrin domain of the ASC and NALP1 proteins were simulated at two different pH values, 3.7 and 6.5, with two different force-field parameter sets, and the molecular dynamics simulation trajectories were compared to NMR experimental data
18311798 Observational study of genotype prevalence. (HuGE Navigator)
18263805 Relative copy numbers for the inflammasome mRNAs for ASC, caspase-1, NALP1, and Pypaf-7 were significantly lower in patients with septic shock compared with critically ill control subjects.
17986858 The ASC/TMS1 gene is frequently silenced in colorectal cancer due to promoter hypermethylation.
17964261 PSTPIP1 mutants require pyrin to induce formation of ASC pyroptosome, a molecular platform that recruits and activates caspase-1.
17599361 Correlation was observed between promoter methylation and loss of protein expression confirming our hypothesis that promoter methylation is an important mechanism for transcriptional silencing of these genes in breast cancer
17048097 Hypermethylation of the proapoptotic gene TMS1 is associated with glioblastoma multiforme
16964285 ASC, like death receptors, mediates two types of apoptosis depending on the cell type, in a manner involving caspase-8
16848908 Study demonstrates that methylation-mediated silencing of TMS1/ASC is a frequent event in prostate cancer.
16777061 ASC expression correlates with IL-8 secretion and may play an important role in maintaining mucosal homeostasis
16715133 Epigenetic silencing of TMS1 may contribute to carcinogenesis
16425203 methylation of adjacent normal tissue occurs significantly more often in prostate cancer patients who later undergo biochemical recurrence, suggesting a role for inactivation of the ASC gene in the initial stages of aggressive disease
16037825 data suggest that both pyrin and cryopyrin are capable of assembling independent inflammasome complexes with ASC and procaspase-1, and activating caspase-1 via ASC oligomerization
15701651 caspase-8 plays an important role in the ASC-mediated NF-kappaB activation and IL-8 production, which actually induces physiologically relevant gene expression
15641782 A coherent interaction surface is identified in apoptosis-associated speck-like protein containing a caspase recruitment domain, establishing a molecular model of PYRIN domain (PYD)-PYD complexes with an important role for charge-charge interactions.
15041718 Methylation-mediated silencing of TMS1/ASC confers a survival advantage to ovarian tumor cells.
15020601 ASC has a role in cryopyrin-induced interleukin 1beta secretion in monocytic cells
14985395 cellular location of pyrin mutant isoforms, in the presence or absence of ASC protein
14730312 Results suggest that apoptosis-associated speck-like protein (ASC) can function as an adaptor molecule for Bax and regulate a p53-Bax mitochondrial pathway of apoptosis.
14643031 Methylation of ASC protein is associated with colorectal cancer
14634131 ASC binds by its caspase recruitment domain (CARD) to procaspase-1 and to adapter proteins involved in caspase-1 activation, thereby regulating cytokine pro-IL-1 beta activation by this protease in monocytic leukemia THP-1 cells.
14499617 electrostatic interactions play an important role for the binding between PYRIN domains in ASC protein
12949795 Downregulated by aberrant methylation of Tms1 is associated with melanoma
12800194 Aberrant methylation of TMS1 is associated with pathogenesis of small cell, non small cell lung cancer and breast cancer
12776200 gene silencing and dense methylation are tightly coupled events that affect individual chromosomal copies of TMS1 in an all-or-none manner
12646168 ASC is a mediator of NF-kappa B activation and Caspase-8-dependent apoptosis in an Ipaf signaling pathway
12615073 there is a cryopyrin signaling pathway activated through the induced proximity of ASC, which is negatively regulated by pyrin
12553049 Results suggest a direct role for aberrant methylation of the TMS1 gene in the progression of breast and gastric cancer involving down-regulation of the proapoptotic TMS1 gene.
12486103 findings suggest that ASC modulates diverse NF-kappaB induction pathways by acting upon the IKK complex, implying a broad role for this and similar proteins containing PAAD domains in regulation of inflammatory responses
12191486 inflammasome comprises caspase-1, caspase-5, Pycard/Asc, and NALP1; a molecular platform triggering activation of inflammatory caspases and processing of proIL-beta
12054656 ASC, which is composed of a PYD and a CARD, is up-regulated by inflammation and apoptosis in human neutrophils
11967258 The PYRIN-CARD protein ASC is an activating adaptor for caspase-1.
11733524 there are sites of protein binding and/or structural transitions define the boundaries of the unmethylated CpG island in normal cells and aberrant methylation overcomes these boundaries to direct change in chromatin structure, resulting in gene silencing.
11103777 Proapoptotic CARD protein. Subcellular redistribution into perinuclear spherical structure appears to precede the downstream activation of a caspase-9-mediated apoptotic pathway. Does not activate NK-kB-dependent transcription.
11103776 Same as TMS1(target of methylation-induced silencing-1). TMS1/ASC found to be inactivated in association with promoter region methylation in human breast cancer cell lines and tumors.

AA Sequence

MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTA      1 - 70
NVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKV     71 - 140
LTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS                   141 - 195
//

Text Mined References (125)

PMID Year Title
26468282 2015 The Inflammasome Adaptor ASC Induces Procaspase-8 Death Effector Domain Filaments.
26457439 2016 Activation of NLRP3 inflammasome in human middle ear cholesteatoma and chronic otitis media.
26093088 2015 Epigenetic inactivation of the candidate tumor suppressor gene ASC/TMS1 in human renal cell carcinoma and its role as a potential therapeutic target.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25567507 2015 Purification and analysis of the interactions of caspase-1 and ASC for assembly of the inflammasome.
25416956 2014 A proteome-scale map of the human interactome network.
25402006 2015 In silico prediction of physical protein interactions and characterization of interactome orphans.
25372293 2014 Caspase-1/ASC inflammasome-mediated activation of IL-1?-ROS-NF-?B pathway for control of Trypanosoma cruzi replication and survival is dispensable in NLRP3-/- macrophages.
25205754 2014 Neutralization of ASC improves sperm motility in men with spinal cord injury.
25191796 2014 Potential diagnostic significance of HSP90, ACS/TMS1, and L-plastin in the identification of melanoma.
25061439 2014 Deregulation of the IL-1? axis in chronic recurrent multifocal osteomyelitis.
25011057 2014 Transcriptome analysis of human adipocytes implicates the NOD-like receptor pathway in obesity-induced adipose inflammation.
25006247 2014 Identification of multifaceted binding modes for pyrin and ASC pyrin domains gives insights into pyrin inflammasome assembly.
24630722 2014 Unified polymerization mechanism for the assembly of ASC-dependent inflammasomes.
24585381 2014 Self-oligomerization of ASC PYD domain prevents the assembly of inflammasome in vitro.
24469054 2015 ASC deficiency suppresses proliferation and prevents medulloblastoma incidence.
24407287 2014 Promyelocytic leukemia protein interacts with the apoptosis-associated speck-like protein to limit inflammasome activation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24237704 2013 Human cytomegalovirus tegument protein pUL83 inhibits IFI16-mediated DNA sensing for immune evasion.
24169962 2013 Genes with aberrant expression in murine preneoplastic intestine show epigenetic and expression changes in normal mucosa of colon cancer patients.
24158569 2014 Nickel induces interleukin-1? secretion via the NLRP3-ASC-caspase-1 pathway.
23839215 2013 Human innate immunity to Toxoplasma gondii is mediated by host caspase-1 and ASC and parasite GRA15.
23811549 2013 MiR-143 induces expression of AIM2 and ASC in Jurkat cell line.
23110696 2013 The CARD plays a critical role in ASC foci formation and inflammasome signalling.
23090995 2012 Tissue-specific opposing functions of the inflammasome adaptor ASC in the regulation of epithelial skin carcinogenesis.
23066025 2012 Multiple binding sites on the pyrin domain of ASC protein allow self-association and interaction with NLRP3 protein.
23064206 2012 Sodium butyrate restores ASC expression and induces apoptosis in LS174T cells.
22934972 2013 Apoptosis-associated speck-like protein containing a CARD (ASC) expression profiles in familial Mediterranean fever (FMF) patients with different MEFV mutation patterns.
22931929 2013 Dual role of apoptosis-associated speck-like protein containing a CARD (ASC) in tumorigenesis of human melanoma.
22732093 2012 Central and overlapping role of Cathepsin B and inflammasome adaptor ASC in antigen presenting function of human dendritic cells.
22295065 2012 TLR2/MyD88/NF-?B pathway, reactive oxygen species, potassium efflux activates NLRP3/ASC inflammasome during respiratory syncytial virus infection.
22286270 2012 Activation of autophagy by inflammatory signals limits IL-1? production by targeting ubiquitinated inflammasomes for destruction.
22230750 2012 Correlation between promoter methylation of p14(ARF), TMS1/ASC, and DAPK, and p53 mutation with prognosis in cholangiocarcinoma.
21832064 2011 Caspase-1 protein induces apoptosis-associated speck-like protein containing a caspase recruitment domain (ASC)-mediated necrosis independently of its catalytic activity.
21575908 2011 IFI16 acts as a nuclear pathogen sensor to induce the inflammasome in response to Kaposi Sarcoma-associated herpesvirus infection.
21487011 2011 The NLR adaptor ASC/PYCARD regulates DUSP10, mitogen-activated protein kinase (MAPK), and chemokine induction independent of the inflammasome.
21270336 2011 Inflammasome-independent role of the apoptosis-associated speck-like protein containing CARD (ASC) in the adjuvant effect of MF59.
21269460 2011 Initial characterization of the human central proteome.
21124315 2011 A role for mitochondria in NLRP3 inflammasome activation.
21104989 2011 Hypermethylation of apoptotic genes as independent prognostic factor in neuroblastoma disease.
21058222 2010 Analysis of cryopyrin-associated periodic syndromes (CAPS) in German children: epidemiological, clinical and genetic characteristics.
21036703 2010 Methylation-mediated silencing of TMS1 in pancreatic cancer and its potential contribution to chemosensitivity.
20926535 2011 Demethylation of TMS1 gene sensitizes thyroid cancer cells to TRAIL-induced apoptosis.
20808838 2010 Granuloma formation and host defense in chronic Mycobacterium tuberculosis infection requires PYCARD/ASC but not NLRP3 or caspase-1.
20500518 2010 Activation of ASC induces apoptosis or necrosis, depending on the cell type, and causes tumor eradication.
20482797 2010 Differential splicing of the apoptosis-associated speck like protein containing a caspase recruitment domain (ASC) regulates inflammasomes.
20148899 2010 Mycobacterium tuberculosis protein ESAT-6 is a potent activator of the NLRP3/ASC inflammasome.
20140741 2010 Epigenetic alterations in disseminated neuroblastoma tumour cells: influence of TMS1 gene hypermethylation in relapse risk in NB patients.
20020448 2010 Kinetic properties of ASC protein aggregation in epithelial cells.
19915568 2010 Recognition of RNA virus by RIG-I results in activation of CARD9 and inflammasome signaling for interleukin 1 beta production.
19759850 2009 A splice variant of ASC regulates IL-1beta release and aggregates differently from intact ASC.
19759015 2009 Structure and interdomain dynamics of apoptosis-associated speck-like protein containing a CARD (ASC).
19661336 2009 Methylation mediated silencing of TMS1 in breast cancer and its potential contribution to docetaxel cytotoxicity.
19636848 2007 1H, 15N and 13C backbone and side chain chemical shifts of human ASC (apoptosis-associated speck-like protein containing a CARD domain).
19494289 2009 Mechanism and repertoire of ASC-mediated gene expression.
19443857 2009 MS-qFRET: a quantum dot-based method for analysis of DNA methylation.
19324871 2009 Methylation-sensitive regulation of TMS1/ASC by the Ets factor, GA-binding protein-alpha.
19258216 2009 CpG island methylation of TMS1/ASC and CASP8 genes in cervical cancer.
19234215 2009 Activation of inflammasomes requires intracellular redistribution of the apoptotic speck-like protein containing a caspase recruitment domain.
19223547 2009 Silencing of TMS1/ASC promotes resistance to anoikis in breast epithelial cells.
19201894 2009 Critical role of apoptotic speck protein containing a caspase recruitment domain (ASC) and NLRP3 in causing necrosis and ASC speck formation induced by Porphyromonas gingivalis in human cells.
19158679 2009 An orthogonal proteomic-genomic screen identifies AIM2 as a cytoplasmic DNA sensor for the inflammasome.
19158676 2009 AIM2 activates the inflammasome and cell death in response to cytoplasmic DNA.
19158675 2009 AIM2 recognizes cytosolic dsDNA and forms a caspase-1-activating inflammasome with ASC.
18945969 2009 Stroma-dependent apoptosis in clonal hematopoietic precursors correlates with expression of PYCARD.
18791131 2008 Expression of ASC in renal tissues of familial mediterranean fever patients with amyloidosis: postulating a role for ASC in AA type amyloid deposition.
18701507 2008 Role of hMOF-dependent histone H4 lysine 16 acetylation in the maintenance of TMS1/ASC gene activity.
18362139 2008 Mapping of POP1-binding site on pyrin domain of ASC.
18348116 2008 A molecular dynamics study of the ASC and NALP1 pyrin domains at neutral and low pH.
18311798 2008 Gene polymorphisms in the NALP3 inflammasome are associated with interleukin-1 production and severe inflammation: relation to common inflammatory diseases?
18263805 2008 Inflammasome mRNA expression in human monocytes during early septic shock.
17986858 2007 Methylation-induced silencing of ASC/TMS1, a pro-apoptotic gene, is a late-stage event in colorectal cancer.
17964261 2007 Pyrin activates the ASC pyroptosome in response to engagement by autoinflammatory PSTPIP1 mutants.
17599361 2007 Promoter hypermethylation of TMS1, BRCA1, ERalpha and PRB in serum and tumor DNA of invasive ductal breast carcinoma patients.
17599095 2007 The pyroptosome: a supramolecular assembly of ASC dimers mediating inflammatory cell death via caspase-1 activation.
17418785 2007 Bcl-2 and Bcl-XL regulate proinflammatory caspase-1 activation by interaction with NALP1.
17349957 2007 Reconstituted NALP1 inflammasome reveals two-step mechanism of caspase-1 activation.
17339483 2007 Pyrin-only protein 2 modulates NF-kappaB and disrupts ASC:CLR interactions.
17178784 2007 Cellular pyrin domain-only protein 2 is a candidate regulator of inflammasome activation.
17048097 2007 Hypermethylation of the proapoptotic gene TMS1/ASC: prognostic importance in glioblastoma multiforme.
16982856 2006 Cutting edge: ASC mediates the induction of multiple cytokines by Porphyromonas gingivalis via caspase-1-dependent and -independent pathways.
16964285 2007 Mechanism of ASC-mediated apoptosis: bid-dependent apoptosis in type II cells.
16848908 2006 Methylation mediated silencing of TMS1/ASC gene in prostate cancer.
16777061 2006 Regulation of the ASC expression in response to LPS stimulation is related to IL-8 secretion in the human intestinal mucosa.
16715133 2006 Dual role of TMS1/ASC in death receptor signaling.
16585594 2006 ASC directs NF-kappaB activation by regulating receptor interacting protein-2 (RIP2) caspase-1 interactions.
16425203 2006 Methylation of the ASC gene promoter is associated with aggressive prostate cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16037825 2006 Cryopyrin and pyrin activate caspase-1, but not NF-kappaB, via ASC oligomerization.
15701651 2005 ASC-mediated NF-kappaB activation leading to interleukin-8 production requires caspase-8 and is inhibited by CLARP.
15641782 2005 Role of charged and hydrophobic residues in the oligomerization of the PYRIN domain of ASC.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456791 2004 PAN1/NALP2/PYPAF2, an inducible inflammatory mediator that regulates NF-kappaB and caspase-1 activation in macrophages.
15096476 2004 PYNOD, a novel Apaf-1/CED4-like protein is an inhibitor of ASC and caspase-1.
15041718 2004 Epigenetic inactivation of TMS1/ASC in ovarian cancer.
15030775 2004 NALP3 forms an IL-1beta-processing inflammasome with increased activity in Muckle-Wells autoinflammatory disorder.
15020601 2004 Cryopyrin-induced interleukin 1beta secretion in monocytic cells: enhanced activity of disease-associated mutants and requirement for ASC.
14985395 2004 Subcellular localisation of marenostrin/pyrin isoforms carrying the most common mutations involved in familial Mediterranean fever in the presence or absence of its binding partner ASC.
14730312 2004 ASC is a Bax adaptor and regulates the p53-Bax mitochondrial apoptosis pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14643031 2003 Methylation of ASC/TMS1, a proapoptotic gene responsible for activating procaspase-1, in human colorectal cancer.
14634131 2003 Apoptosis-associated speck-like protein containing a caspase recruitment domain is a regulator of procaspase-1 activation.
14499617 2003 The death-domain fold of the ASC PYRIN domain, presenting a basis for PYRIN/PYRIN recognition.
12949795 2003 ASC/TMS1, a caspase-1 activating adaptor, is downregulated by aberrant methylation in human melanoma.
12800194 2003 Aberrant methylation of TMS1 in small cell, non small cell lung cancer and breast cancer.
12776200 2003 Effects of methylation on expression of TMS1/ASC in human breast cancer cells.
12656673 2003 The PAAD/PYRIN-only protein POP1/ASC2 is a modulator of ASC-mediated nuclear-factor-kappa B and pro-caspase-1 regulation.
12646168 2003 ASC is an activating adaptor for NF-kappa B and caspase-8-dependent apoptosis.
12615073 2003 Regulation of cryopyrin/Pypaf1 signaling by pyrin, the familial Mediterranean fever gene product.
12553049 A proapoptotic caspase recruitment domain protein gene, TMS1, is hypermethylated in human breast and gastric cancers.
12486103 2002 The PAAD/PYRIN-family protein ASC is a dual regulator of a conserved step in nuclear factor kappaB activation pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12191486 2002 The inflammasome: a molecular platform triggering activation of inflammatory caspases and processing of proIL-beta.
12054656 2002 ASC, which is composed of a PYD and a CARD, is up-regulated by inflammation and apoptosis in human neutrophils.
12019269 2002 PYPAF7, a novel PYRIN-containing Apaf1-like protein that regulates activation of NF-kappa B and caspase-1-dependent cytokine processing.
11967258 2002 The PYRIN-CARD protein ASC is an activating adaptor for caspase-1.
11786556 2002 PYPAF1, a PYRIN-containing Apaf1-like protein that assembles with ASC and regulates activation of NF-kappa B.
11733524 2002 Methylation-mediated silencing of TMS1/ASC is accompanied by histone hypoacetylation and CpG island-localized changes in chromatin architecture.
11498534 2001 Interaction between pyrin and the apoptotic speck protein (ASC) modulates ASC-induced apoptosis.
11374873 2001 Human CARD12 is a novel CED4/Apaf-1 family member that induces apoptosis.
11250163 2001 The pyrin domain: a possible member of the death domain-fold family implicated in apoptosis and inflammation.
11103777 2000 Activation of a caspase-9-mediated apoptotic pathway by subcellular redistribution of the novel caspase recruitment domain protein TMS1.
11103776 2000 TMS1, a novel proapoptotic caspase recruitment domain protein, is a target of methylation-induced gene silencing in human breast cancers.
10847592 2000 Activating protein-1, nuclear factor-kappaB, and serum response factor as novel target molecules of the cancer-amplified transcription coactivator ASC-2.
10567338 1999 ASC, a novel 22-kDa protein, aggregates during apoptosis of human promyelocytic leukemia HL-60 cells.