Property Summary

NCBI Gene PubMed Count 5
PubMed Score 92.38
PubTator Score 3.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

 GWAS Trait (1)

Pathway (1)

Protein-protein Interaction (3)

Gene RIF (2)

PMID Text
24425863 this study describes the cloning of a human cDNA encoding a novel protein designated 2-phosphoxylose phosphatase capable of dephosphorylating this Xyl residue.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MLFRNRFLLLLALAALLAFVSLSLQFFHLIPVSTPKNGMSSKSRKRIMPDPVTEPPVTDPVYEALLYCNI      1 - 70
PSVAERSMEGHAPHHFKLVSVHVFIRHGDRYPLYVIPKTKRPEIDCTLVANRKPYHPKLEAFISHMSKGS     71 - 140
GASFESPLNSLPLYPNHPLCEMGELTQTGVVQHLQNGQLLRDIYLKKHKLLPNDWSADQLYLETTGKSRT    141 - 210
LQSGLALLYGFLPDFDWKKIYFRHQPSALFCSGSCYCPVRNQYLEKEQRRQYLLRLKNSQLEKTYGEMAK    211 - 280
IVDVPTKQLRAANPIDSMLCHFCHNVSFPCTRNGCVDMEHFKVIKTHQIEDERERREKKLYFGYSLLGAH    281 - 350
PILNQTIGRMQRATEGRKEELFALYSAHDVTLSPVLSALGLSEARFPRFAARLIFELWQDREKPSEHSVR    351 - 420
ILYNGVDVTFHTSFCQDHHKRSPKPMCPLENLVRFVKRDMFVALGGSGTNYYDACHREGF              421 - 480
//

Text Mined References (7)

PMID Year Title
24425863 2014 Identification of phosphatase that dephosphorylates xylose in the glycosaminoglycan-protein linkage region of proteoglycans.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.