Property Summary

NCBI Gene PubMed Count 24
PubMed Score 15.54
PubTator Score 12.83

Knowledge Summary

Patent (1,344)

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid Arthritis 1.900 2.4e-02
osteosarcoma 1.050 1.1e-02
posterior fossa group B ependymoma -1.300 6.4e-05
atypical teratoid/rhabdoid tumor -1.400 1.1e-04
medulloblastoma, large-cell -1.900 2.0e-04
adult high grade glioma -1.200 4.1e-03
sonic hedgehog group medulloblastoma -1.600 1.3e-03
subependymal giant cell astrocytoma -2.727 1.2e-03
lung adenocarcinoma -1.100 2.0e-11
Pick disease -2.300 1.6e-04
progressive supranuclear palsy -2.200 9.3e-03
invasive ductal carcinoma -1.200 9.7e-03
ovarian cancer -2.700 3.5e-10

Gene RIF (17)

PMID Text
25852190 Two of these kinases that were classified as resistors were PX domain-containing serine/threonine kinase (PXK) and AP2-associated kinase 1 (AAK1), which promote receptor endocytosis and may enable cells to resist TRAIL-induced apoptosis
25596907 genetic association study in Han population in China: Data suggest an SNP in PXK [rs2176082(C/T); but not rs6445975(G/T)] is associated with recurrent pregnancy loss; SNPs in KIAA0319L [rs2275247(A/G)] or JAZF1 [rs1635852(C/T)] are not associated.
24534757 Results confirm the genetic association of the locus 3p14.3 with systemic lupus erythematosus in Europeans and point to the ABHD6 and not PXK, as the major susceptibility gene in the region.
23740937 study determined that the previously described systemic lupus erythematosus susceptibility loci PXK (P = 3.27 x 10(-11), OR = 1.20) and JAZF1 (P = 1.11 x 10(-8), OR = 1.13) are shared with systemic sclerosis
22592861 The rs6445975 polymorphism of PXK and the rs2304256 polymorphism of tyrosine kinase 2 are associated with the development of systemic lupus erythematosus in Europeans
21243490 The association of PXK rs6445975 with systemic lupus erythematosus that was previously observed in Caucasians was not replicated in Koreans or in Hong Kong Chinese.
20962850 Observational study of gene-disease association. (HuGE Navigator)
20881011 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20848568 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20829310 Observational study of gene-disease association. (HuGE Navigator)
20453842 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20086096 These results indicate that PXK plays a critical role in epidermal growth factor receptor trafficking through modulating ligand-induced ubiquitination of the receptor.
19225526 Observational study of gene-disease association. (HuGE Navigator)
18204446 Genome-wide association study of gene-disease association. (HuGE Navigator)
18204446 study presents four new regions having genetic associations with systemic lupus erythematosus in women of European descent: ITGAM, KIAA1542, PXK and rs10798269
16135750 MONaKA modulates brain Na,K-ATPase by binding tightly to its beta1 and beta3 subunits, and may thereby participate in the regulation of electrical excitability and synaptic transmission [MONaKA]

AA Sequence

MAFMEKPPAGKVLLDDTVPLTAAIEASQSLQSHTEYIIRVQRGISVENSWQIVRRYSDFDLLNNSLQIAG      1 - 70
LSLPLPPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLDPNNYSANYTEIALQQVSMFF     71 - 140
RSEPKWEVVEPLKDIGWRIRKKYFLMKIKNQPKERLVLSWADLGPDKYLSDKDFQCLIKLLPSCLHPYIY    141 - 210
RVTFATANESSALLIRMFNEKGTLKDLIYKAKPKDPFLKKYCNPKKIQGLELQQIKTYGRQILEVLKFLH    211 - 280
DKGFPYGHLHASNVMLDGDTCRLLDLENSLLGLPSFYRSYFSQFRKINTLESVDVHCFGHLLYEMTYGRP    281 - 350
PDSVPVDSFPPAPSMAVVAVLESTLSCEACKNGMPTISRLLQMPLFSDVLLTTSEKPQFKIPTKLKEALR    351 - 420
IAKECIEKRLIEEQKQIHQHRRLTRAQSHHGSEEERKKRKILARKKSKRSALENSEEHSAKYSNSNNSAG    421 - 490
SGASSPLTSPSSPTPPSTSGISALPPPPPPPPPPAAPLPPASTEAPAQLSSQAVNGMSRGALLSSIQNFQ    491 - 560
KGTLRKAKTCDHSAPKIG                                                        561 - 578
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25596907 2015 Association between KIAA0319L, PXK and JAZF1 gene polymorphisms and unexplained recurrent pregnancy loss in Chinese Han couples.
24534757 2015 PXK locus in systemic lupus erythematosus: fine mapping and functional analysis reveals novel susceptibility gene ABHD6.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23740937 2013 A systemic sclerosis and systemic lupus erythematosus pan-meta-GWAS reveals new shared susceptibility loci.
22592861 2012 Associations between PXK and TYK2 polymorphisms and systemic lupus erythematosus: a meta-analysis.
21243490 2012 Different genetic effect of PXK on systemic lupus erythematosus in the Korean population.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
20881011 2011 Early disease onset is predicted by a higher genetic risk for lupus and is associated with a more severe phenotype in lupus patients.
20848568 2010 Genetically determined Amerindian ancestry correlates with increased frequency of risk alleles for systemic lupus erythematosus.
20829310 2011 Polymorphisms of PXK are associated with autoantibody production, but not disease risk, of systemic lupus erythematosus in Chinese mainland population.
20453842 2010 Genome-wide association study meta-analysis identifies seven new rheumatoid arthritis risk loci.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20086096 2010 Characterization of PXK as a protein involved in epidermal growth factor receptor trafficking.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19225526 2009 Population differences in SLE susceptibility genes: STAT4 and BLK, but not PXK, are associated with systemic lupus erythematosus in Hong Kong Chinese.
18204446 2008 Genome-wide association scan in women with systemic lupus erythematosus identifies susceptibility variants in ITGAM, PXK, KIAA1542 and other loci.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16142408 2005 Expression pattern and subcellular localization of five splice isoforms of human PXK.
16135750 2005 MONaKA, a novel modulator of the plasma membrane Na,K-ATPase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.