Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytoma 1.400 4.1e-27
Astrocytoma, Pilocytic 1.600 1.0e-08
Breast cancer -1.400 3.8e-08
colon cancer -1.100 3.2e-02
dermatomyositis 1.400 2.8e-03
diabetes mellitus -1.200 1.4e-02
glioblastoma 1.200 3.5e-06
invasive ductal carcinoma -1.100 4.1e-02
lung adenocarcinoma -1.100 3.0e-09
lung cancer -2.200 8.8e-05
lung carcinoma -2.000 4.3e-20
medulloblastoma, large-cell -1.400 3.7e-04
non diabetic and post-ischemic heart fai... -1.500 3.0e-03
non-small cell lung cancer -1.076 2.3e-17
oligodendroglioma 1.100 3.1e-02
pancreatic ductal adenocarcinoma liver m... -1.719 9.5e-04
pediatric high grade glioma 1.200 2.8e-05
pituitary cancer -1.200 5.2e-04
psoriasis -1.100 5.3e-12
subependymal giant cell astrocytoma 1.208 3.4e-03
ulcerative colitis 1.600 2.2e-06

 Compartment GO Term (1)

AA Sequence

MASAVFEGTSLVNMFVRGCWVNGIRRLIVSRRGDEEEFFEIRTEWSDRSVLYLHRSLADLGRLWQRLRDA      1 - 70
FPEDRSELAQGPLRQGLVAIKEAHDIETRLNEVEKLLKTIISMPCKYSRSEVVLTFFERSPLDQVLKNDN     71 - 140
VHKIQPSFQSPVKISEIMRSNGFCLANTETIVIDHSIPNGRDQQLGVDPTEHLFENGSEFPSELEDGDDP    141 - 210
AAYVTNLSYYHLVPFETDIWD                                                     211 - 231
//

Text Mined References (7)

PMID Year Title