Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.100 1.4e-02
gastric cancer 1.100 1.3e-03
group 3 medulloblastoma 1.200 4.3e-02
intraductal papillary-mucinous neoplasm ... 1.200 2.2e-02
osteosarcoma 2.193 3.4e-06
ovarian cancer -1.800 3.6e-07
tuberculosis and treatment for 6 months -1.300 7.5e-04
ulcerative colitis -1.100 3.9e-04

Gene RIF (1)

AA Sequence

MAAVAAEAAATAASPGEGGAGEAEPEMEPIPGSEAGTDPLPVTATEASVPDGETDGQQSAPQADEPPLPP      1 - 70
PPPPPGELARSPEAVGPELEAEEKLSVRVAESAAAAPQGGPELPPSPASPPEQPPAPEEREEPPLPQPVA     71 - 140
PALVPPAGGDSTVSQLIPGSEVRVTLDHIIEDALVVSFRFGEKLFSGVLMDLSKRFGPHGIPVTVFPKRE    141 - 210
YKDKPEAMPLQSNTFQEGTEVKCEANGAVPDDPSPVPHPELSLAESLWTSKPPPLFHEGAPYPPPLFIRD    211 - 280
TYNQSIPQPPPRKIKRPKRKMYREEPTSIMNAIKLRPRQVLCDKCKNSVVAEKKEIRKGSSATDSSKYED    281 - 350
KKRRNESVTTVNKKLKTDHKVDGKNQNESQKRNAVVKVSNIAHSRGRVVKVSAQANTSKAQLSTKKVLQS    351 - 420
KNMDHAKAREVLKIAKEKAQKKQNETSTSKNAHSKVHFTRRYQNPSSGSLPPRVRLKPQRYRNEENDSSL    421 - 490
KTGLEKMRSGKMAPKPQSRCTSTRSAGEAPSENQSPSKGPEEASSEVQDTNEVHVPGDQDEPQTLGKKGS    491 - 560
KNNISVYMTLNQKKSDSSSASVCSIDSTDDLKSSNSECSSSESFDFPPGSMHAPSTSSTSSSSKEEKKLS    561 - 630
NSLKMKVFSKNVSKCVTPDGRTICVGDIVWAKIYGFPWWPARILTITVSRKDNGLLVRQEARISWFGSPT    631 - 700
TSFLALSQLSPFLENFQSRFNKKRKGLYRKAITEAAKAAKQLTPEVRALLTQFET                   701 - 755
//

Text Mined References (18)

PMID Year Title