Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.33
PubTator Score 3.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 1.7e-08
ovarian cancer 8491 3.0e-08
psoriasis 6685 1.7e-05
lung cancer 4473 5.1e-04
dermatomyositis 966 7.3e-04
Waldenstrons macroglobulinemia 764 1.2e-03
Multiple myeloma 1327 2.8e-03
group 3 medulloblastoma 2254 4.9e-03
Disease Target Count Z-score Confidence
Cardiac tamponade 4 3.657 1.8

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.169 1.2e-03
Multiple myeloma 1.328 2.8e-03
psoriasis 2.500 1.7e-05
osteosarcoma 3.166 1.7e-08
lung cancer 2.100 5.1e-04
group 3 medulloblastoma 1.200 4.9e-03
ovarian cancer 3.100 3.0e-08
dermatomyositis 1.500 7.3e-04

Synonym

Accession Q13610 A8K3R6 Q7Z3X9
Symbols IEF-SSP-9502

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
20028516 Endonuclein interacts with several proteins indicating a broad function including signal transduction and chaperone activity

AA Sequence

MNRSRQVTCVAWVRCGVAKETPDKVELSKEEVKRLIAEAKEKLQEEGGGSDEEETGSPSEDGMQSARTQA      1 - 70
RPREPLEDGDPEDDRTLDDDELAEYDLDKYDEEGDPDAETLGESLLGLTVYGSNDQDPYVTLKDTEQYER     71 - 140
EDFLIKPSDNLIVCGRAEQDQCNLEVHVYNQEEDSFYVHHDILLSAYPLSVEWLNFDPSPDDSTGNYIAV    141 - 210
GNMTPVIEVWDLDIVDSLEPVFTLGSKLSKKKKKKGKKSSSAEGHTDAVLDLSWNKLIRNVLASASADNT    211 - 280
VILWDMSLGKPAASLAVHTDKVQTLQFHPFEAQTLISGSYDKSVALYDCRSPDESHRMWRFSGQIERVTW    281 - 350
NHFSPCHFLASTDDGFVYNLDARSDKPIFTLNAHNDEISGLDLSSQIKGCLVTASADKYVKIWDILGDRP    351 - 420
SLVHSRDMKMGVLFCSSCCPDLPFIYAFGGQKEGLRVWDISTVSSVNEAFGRRERLVLGSARNSSISGPF    421 - 490
GSRSSDTPMES                                                               491 - 501
//

Text Mined References (23)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20028516 2009 Identification and characterization of endonuclein binding proteins: evidence of modulatory effects on signal transduction and chaperone activity.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16541075 2006 The finished DNA sequence of human chromosome 12.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11850830 2002 Endonuclein is a cell cycle regulated WD-repeat protein that is up-regulated in adenocarcinoma of the pancreas.
11790298 2002 Directed proteomic analysis of the human nucleolus.
8895530 1996 A pancreatic cancer-specific expression profile.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7828893 1994 Cloning of a cDNA encoding a novel human nuclear phosphoprotein belonging to the WD-40 family.