Property Summary

NCBI Gene PubMed Count 18
PubMed Score 19.14
PubTator Score 13.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer -1.300 8.9e-06
pancreatic ductal adenocarcinoma liver m... -1.024 5.4e-03

Gene RIF (7)

AA Sequence

MFPLTEENKHVAQLLLNTGTCPRCIFRFCGVDFHAPYKLPYKELLNELQKFLETEKDELILEVMNPPPKK      1 - 70
IRLQELEDSIDNLSQNGEGRISVSHVGSTASKNSNLNVCNVCLGILQEFCEKDFIKKVCQKVEASGFEFT     71 - 140
SLVFSVSFPPQLSVREHAAWLLVKQEMGKQSLSLGRDDIVQLKEAYKWITHPLFSEELGVPIDGKSLFEV    141 - 210
SVVFAHPETVEDCHFLAAICPDCFKPAKNKQSVFTRMAVMKALNKIKEEDFLKQFPCPPNSPKAVCAVLE    211 - 280
IECAHGAVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFNFSSSGREDVDVRTL    281 - 350
GNGRPFAIELVNPHRVHFTSQEIKELQQKINNSSNKIQVRDLQLVTREAIGHMKEGEEEKTKTYSALIWT    351 - 420
NKAIQKKDIEFLNDIKDLKIDQKTPLRVLHRRPLAVRARVIHFMETQYVDEHHFRLHLKTQAGTYIKEFV    421 - 490
HGDFGRTKPNIGSLMNVTADILELDVESVDVDWPPALDD                                   491 - 529
//

Text Mined References (23)

PMID Year Title