Property Summary

NCBI Gene PubMed Count 4
PubMed Score 6.40
PubTator Score 2.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.200 4.5e-04
atypical teratoid / rhabdoid tumor -1.100 1.5e-02
glioblastoma -1.400 1.4e-02
medulloblastoma, large-cell -1.800 1.8e-05

Gene RIF (2)

AA Sequence

MERARRRGGGGGRGRGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASKRVDIQKK      1 - 70
RFYLDVKQSSRGRFLKIAEVWIGRGRQDNIRKSKLTLSLSVAAELKDCLGDFIEHYAHLGLKGHRQEHGH     71 - 140
SKEQGSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDNRKYYLDLKENQRGRFLRIRQTMMRGTGMIG    141 - 210
YFGHSLGQEQTIVLPAQGMIEFRDALVQLIEDYGEGDIEERRGGDDDPLELPEGTSFRVDNKRFYFDVGS    211 - 280
NKYGIFLKVSEVRPPYRNTITVPFKAWTRFGENFIKYEEEMRKICNSHKEKRMDGRKASGEEQECLD       281 - 347
//

Text Mined References (5)

PMID Year Title