Property Summary

NCBI Gene PubMed Count 18
PubMed Score 31.79
PubTator Score 9.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma 1.400 1.2e-04
atypical teratoid / rhabdoid tumor -2.000 2.2e-05
medulloblastoma, large-cell -2.100 4.6e-05
primitive neuroectodermal tumor -1.100 6.5e-05
intraductal papillary-mucinous carcinoma... 1.200 3.4e-02
intraductal papillary-mucinous neoplasm ... 1.100 4.8e-02
pediatric high grade glioma 1.300 2.5e-05
spina bifida -1.188 4.2e-02
Breast cancer -1.200 1.1e-71
ovarian cancer 2.100 1.9e-07

Gene RIF (5)

PMID Text
24446247 Suggest dynamic interplay between transcriptional activators Pur-alpha/Pur-beta and repressors in regulating SMalphaA gene output during myofibroblast differentiation.
22174317 HIV-1 Rev interacting protein, purine-rich element binding protein B (PURB), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with PURB is increased by RRE
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19496623 findings offer insights into mechanism, energetics, and sequence of Purbeta repressor binding to a biologically relevant, contractile phenotype-regulating cis-element while revealing the thermodynamic confines of Purbeta-mediated effects on DNA structure
12933792 results show that PUR proteins are capable of binding to alpha-MHC mRNA and attenuate its translational efficiency; also show robust expression of PUR proteins in failing hearts where alpha-MHC mRNA levels are suppressed

AA Sequence

MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDVKQNAKGRFLKIAEVGAGGSK      1 - 70
SRLTLSMAVAAEFRDSLGDFIEHYAQLGPSSPEQLAAGAEEGGGPRRALKSEFLVRENRKYYLDLKENQR     71 - 140
GRFLRIRQTVNRGGGGFGAGPGPGGLQSGQTIALPAQGLIEFRDALAKLIDDYGGEDDELAGGPGGGAGG    141 - 210
PGGGLYGELPEGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYADEMK    211 - 280
EIQERQRDKLYERRGGGSGGGEESEGEEVDED                                          281 - 312
//

Text Mined References (28)

PMID Year Title
24446247 2014 The Pur?/Pur? single-strand DNA-binding proteins attenuate smooth-muscle actin gene transactivation in myofibroblasts.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19496623 2009 Mechanism of strand-specific smooth muscle alpha-actin enhancer interaction by purine-rich element binding protein B (Purbeta).
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12933792 2003 Single-stranded DNA-binding proteins PURalpha and PURbeta bind to a purine-rich negative regulatory element of the alpha-myosin heavy chain gene and control transcriptional and translational regulation of the gene expression. Implications in the repression of alpha-myosin heavy chain during heart failure.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11417483 2001 Deletions of PURA, at 5q31, and PURB, at 7p13, in myelodysplastic syndrome and progression to acute myelogenous leukemia.
10318844 1999 Molecular interactions between single-stranded DNA-binding proteins associated with an essential MCAT element in the mouse smooth muscle alpha-actin promoter.
9847074 1998 Toward a complete human genome sequence.
1448097 1992 Sequence of cDNA comprising the human pur gene and sequence-specific single-stranded-DNA-binding properties of the encoded protein.