Property Summary

NCBI Gene PubMed Count 19
PubMed Score 30.66
PubTator Score 9.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.300 5.2e-03
atypical teratoid / rhabdoid tumor -1.400 2.2e-06
Breast cancer -1.200 1.1e-71
glioblastoma 1.300 7.6e-06
intraductal papillary-mucinous carcinoma... 1.200 3.4e-02
intraductal papillary-mucinous neoplasm ... 1.100 4.8e-02
medulloblastoma, large-cell -1.700 5.8e-05
ovarian cancer 2.100 1.9e-07
primitive neuroectodermal tumor -1.100 6.5e-05
spina bifida -1.188 4.2e-02

Gene RIF (6)

AA Sequence

MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDVKQNAKGRFLKIAEVGAGGSK      1 - 70
SRLTLSMAVAAEFRDSLGDFIEHYAQLGPSSPEQLAAGAEEGGGPRRALKSEFLVRENRKYYLDLKENQR     71 - 140
GRFLRIRQTVNRGGGGFGAGPGPGGLQSGQTIALPAQGLIEFRDALAKLIDDYGGEDDELAGGPGGGAGG    141 - 210
PGGGLYGELPEGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYADEMK    211 - 280
EIQERQRDKLYERRGGGSGGGEESEGEEVDED                                          281 - 312
//

Text Mined References (29)

PMID Year Title