Property Summary

NCBI Gene PubMed Count 33
PubMed Score 19.75
PubTator Score 25.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
acute quadriplegic myopathy 1157 8.1e-06
ovarian cancer 8491 4.9e-04
subependymal giant cell astrocytoma 2287 2.7e-02
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Essential tremor 30 3.005 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
acute quadriplegic myopathy 1.693 8.1e-06
subependymal giant cell astrocytoma -1.096 2.7e-02
ovarian cancer 1.900 4.9e-04

Gene RIF (16)

PMID Text
26724866 Identification of NORAD-interacting proteins revealed that this lncRNA functions as a multivalent binding platform for PUM proteins, with the capacity to sequester a significant fraction of the total cellular pool of PUM1 and PUM2. Studies reveal unanticipated roles for a lncRNA and PUMILIO proteins in the maintenance of genomic stability.
26517885 Pumilios (including PUM1 and PUM2) are RNA-binding proteins with Puf domains made up of 8 poorly conserved Puf repeats, 3 helix bundles arranged in rainbow architecture, where each repeat recognizes a single base of the RNA-binding sequence. [REVIEW]
22345517 human Pumilio homologs Pum 1 and Pum 2 repress the translation of E2F3 by binding to the E2F3 3' untranslated region (UTR) and also enhance the activity of multiple E2F3 targeting microRNAs (miRNAs)
22231398 Mammalian PUM2-Ago-eEF1A inhibited translation of nonadenylated and polyadenylated reporter mRNAs in vitro.
22190034 HIV-1 PR is identified to have a physical interaction with pumilio homolog 2 (PUM2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21800163 NANOS1-PUMILIO2 complex, together with GEMIN3 and small noncoding RNAs, possibly regulate mRNA translation within the chromatoid body of the human germ cells.
21649561 PUM2 does not repress differentiation of adipose-derived stem cells (ASCs) but rather is involved in the positive control of ASCs division and proliferation.
21589936 in mitosis, PUM2 physically associates with Aurora-A to ensure enough active Aurora-A at centrosomes for mitotic entry
21397187 Three distinct modes of target RNA binding by PUM2 around the fifth mRNA base were observed.
19168546 Data found that PUMILIO2 interacts also with SNAPIN, a modulator of SNARE complex assembly, which is involved in vesicle trafficking.
17154300 Observational study of gene-disease association. (HuGE Navigator)
17154300 Variation in the PUMILIO2 gene is very low and it seems improbable that mutations of this gene significantly contribute to male infertility in humans.
16967088 PUMILIO mediated translational regulation may be universally used in developmental processes of the human body.
15617101 P2P-R expression may be translationally regulated by PUM2
15607425 PUM2 and DAZL, are capable of binding the same mRNA sequences in the 3'UTR of human SDAD1 mRNA.
12511597 PUM2 as a component of conserved cellular machinery that may be required for germ cell development.

AA Sequence

MNHDFQALALESRGMGELLPTKKFWEPDDSTKDGQKGIFLGDDEWRETAWGASHHSMSQPIMVQRRSGQG      1 - 70
FHGNSEVNAILSPRSESGGLGVSMVEYVLSSSPADKLDSRFRKGNFGTRDAETDGPEKGDQKGKASPFEE     71 - 140
DQNRDLKQGDDDDSKINGRGLPNGMDADCKDFNRTPGSRQASPTEVVERLGPNTNPSEGLGPLPNPTANK    141 - 210
PLVEEFSNPETQNLDAMEQVGLESLQFDYPGNQVPMDSSGATVGLFDYNSQQQLFQRTNALTVQQLTAAQ    211 - 280
QQQYALAAAQQPHIAGVFSAGLAPAAFVPNPYIISAAPPGTDPYTAAGLAAAATLAGPAVVPPQYYGVPW    281 - 350
GVYPANLFQQQAAAAANNTASQQAASQAQPGQQQVLRAGAGQRPLTPNQGQQGQQAESLAAAAAANPTLA    351 - 420
FGQGLATGMPGYQVLAPTAYYDQTGALVVGPGARTGLGAPVRLMAPTPVLISSAAAQAAAAAAAGGTASS    421 - 490
LTGSTNGLFRPIGTQPPQQQQQQPSTNLQSNSFYGSSSLTNSSQSSSLFSHGPGQPGSTSLGFGSGNSLG    491 - 560
AAIGSALSGFGSSVGSSASSSATRRESLSTSSDLYKRSSSSLAPIGQPFYNSLGFSSSPSPIGMPLPSQT    561 - 630
PGHSLTPPPSLSSHGSSSSLHLGGLTNGSGRYISAAPGAEAKYRSASSTSSLFSSSSQLFPPSRLRYNRS    631 - 700
DIMPSGRSRLLEDFRNNRFPNLQLRDLIGHIVEFSQDQHGSRFIQQKLERATPAERQMVFNEILQAAYQL    701 - 770
MTDVFGNYVIQKFFEFGSLDQKLALATRIRGHVLPLALQMYGCRVIQKALESISSDQQVISEMVKELDGH    771 - 840
VLKCVKDQNGNHVVQKCIECVQPQSLQFIIDAFKGQVFVLSTHPYGCRVIQRILEHCTAEQTLPILEELH    841 - 910
QHTEQLVQDQYGNYVIQHVLEHGRPEDKSKIVSEIRGKVLALSQHKFASNVVEKCVTHASRAERALLIDE    911 - 980
VCCQNDGPHSALYTMMKDQYANYVVQKMIDMAEPAQRKIIMHKIRPHITTLRKYTYGKHILAKLEKYYLK    981 - 1050
NSPDLGPIGGPPNGML                                                         1051 - 1066
//

Text Mined References (45)

PMID Year Title
26724866 2016 Noncoding RNA NORAD Regulates Genomic Stability by Sequestering PUMILIO Proteins.
26517885 2015 Bespoke RNA recognition by Pumilios.
25349211 2014 SCCRO3 (DCUN1D3) antagonizes the neddylation and oncogenic activity of SCCRO (DCUN1D1).
25340845 2014 A novel function of human Pumilio proteins in cytoplasmic sensing of viral infection.
25100735 2014 Post-transcriptional gene expression control by NANOS is up-regulated and functionally important in pRb-deficient cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22955276 2012 Human Pumilio proteins recruit multiple deadenylases to efficiently repress messenger RNAs.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22345517 2012 Pumilio facilitates miRNA regulation of the E2F3 oncogene.
22231398 2012 A conserved PUF-Ago-eEF1A complex attenuates translation elongation.
22190034 2011 Global landscape of HIV-human protein complexes.
21800163 2011 NANOS1 and PUMILIO2 bind microRNA biogenesis factor GEMIN3, within chromatoid body in human germ cells.
21649561 2012 PUMILIO-2 is involved in the positive regulation of cellular proliferation in human adipose-derived stem cells.
21589936 2011 A translational regulator, PUM2, promotes both protein stability and kinase activity of Aurora-A.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21397187 2011 Alternate modes of cognate RNA recognition by human PUMILIO proteins.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19168546 2009 The SNARE-associated component SNAPIN binds PUMILIO2 and NANOS1 proteins in human male germ cells.
18776931 2008 Comparative analysis of mRNA targets for human PUF-family proteins suggests extensive interaction with the miRNA regulatory system.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17154300 2007 Polymorphisms of the human PUMILIO2 gene and male sterility.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16967088 2006 Candidate mRNAs interacting with fertility protein PUMILIO2 in the human germ line.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15617101 2005 P2P-R expression is genetically coregulated with components of the translation machinery and with PUM2, a translational repressor that associates with the P2P-R mRNA.
15607425 2005 Identification and characterization of RNA sequences to which human PUMILIO-2 (PUM2) and deleted in Azoospermia-like (DAZL) bind.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12771951 2003 Genome-wide comparison of human keratinocyte and squamous cell carcinoma responses to UVB irradiation: implications for skin and epithelial cancer.
12690449 2003 Conservation of a Pumilio-Nanos complex from Drosophila germ plasm to human germ cells.
12511597 2003 Human Pumilio-2 is expressed in embryonic stem cells and germ cells and interacts with DAZ (Deleted in AZoospermia) and DAZ-like proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12459267 2002 Cloning and comparative sequence analysis of PUM1 and PUM2 genes, human members of the Pumilio family of RNA-binding proteins.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.