Property Summary

NCBI Gene PubMed Count 39
PubMed Score 20.68
PubTator Score 26.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung adenocarcinoma 2714 4.3e-10
osteosarcoma 7933 2.3e-07
ovarian cancer 8491 3.9e-04
Multiple myeloma 1327 1.0e-03
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Subcorneal pustular dermatosis 2 3.277 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.340 1.0e-03
osteosarcoma 2.065 2.3e-07
lung adenocarcinoma 1.476 4.3e-10
ovarian cancer 1.400 3.9e-04

Protein-protein Interaction (3)

Gene RIF (13)

PMID Text
26724866 Identification of NORAD-interacting proteins revealed that this lncRNA functions as a multivalent binding platform for PUM proteins, with the capacity to sequester a significant fraction of the total cellular pool of PUM1 and PUM2.Studies reveal unanticipated roles for a lncRNA and PUMILIO proteins in the maintenance of genomic stability.
26517885 Pumilios (including PUM1 and PUM2) are RNA-binding proteins with Puf domains made up of 8 poorly conserved Puf repeats, 3 helix bundles arranged in rainbow architecture, where each repeat recognizes a single base of the RNA-binding sequence. [REVIEW]
25512524 PUM repeats have now been identified in proteins that function in pre-rRNA processing, including human Puf-A and yeast Puf6.
23625657 The promoting effect of hPuf-A in tumorigenesis might be correlated with the regulation of its associated mRNAs.
22916034 MED15 and PUM1 proteins with coiled-coil domains are potent enhancers of polyQ-mediated ataxin-1 protein misfolding and proteotoxicity in vitro and in vivo.
22345517 human Pumilio homologs Pum 1 and Pum 2 repress the translation of E2F3 by binding to the E2F3 3' untranslated region (UTR) and also enhance the activity of multiple E2F3 targeting microRNAs (miRNAs)
21397187 Three distinct modes of target RNA binding by PUM1 around the fifth mRNA base were observed.
20818387 Pumilio-1 (PUM1) is a ubiquitously expressed RBP that was shown to interact with p27-3' UTR.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19319195 Puf-A transcripts were uniformly distributed in early embryos, but became restricted primarily to eyes and ovaries at a later stage of development
18411299 ribonomic analysis of mRNAs associated with ribonucleoproteins containing an endogenous human PUF protein, Pum1
18328718 Description of the structures of hPum Puf domain complexed to two noncognate RNAs, CycB(reverse) and Puf5.
18211679 The reference genes of choice when performing RT-qPCR on normal and malignant breast specimens should be either the collected group of 3 genes (TBP, RPLP0 and PUM1) employed as an average, or PUM1 as a single gene.

AA Sequence

MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIG      1 - 70
VAGRSQDDAMVDYFFQRQHGEQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGR     71 - 140
AMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTSDHSVSQPIMVQRRPGQSFHVNSEVNSVLSP    141 - 210
RSESGGLGVSMVEYVLSSSPGDSCLRKGGFGPRDADSDENDKGEKKNKGTFDGDKLGDLKEEGDVMDKTN    211 - 280
GLPVQNGIDADVKDFSRTPGNCQNSANEVDLLGPNQNGSEGLAQLTSTNGAKPVEDFSNMESQSVPLDPM    281 - 350
EHVGMEPLQFDYSGTQVPVDSAAATVGLFDYNSQQQLFQRPNALAVQQLTAAQQQQYALAAAHQPHIGLA    351 - 420
PAAFVPNPYIISAAPPGTDPYTAGLAAAATLGPAVVPHQYYGVTPWGVYPASLFQQQAAAAAAATNSANQ    421 - 490
QTTPQAQQGQQQVLRGGASQRPLTPNQNQQGQQTDPLVAAAAVNSALAFGQGLAAGMPGYPVLAPAAYYD    491 - 560
QTGALVVNAGARNGLGAPVRLVAPAPVIISSSAAQAAVAAAAASANGAAGGLAGTTNGPFRPLGTQQPQP    561 - 630
QPQQQPNNNLASSSFYGNNSLNSNSQSSSLFSQGSAQPANTSLGFGSSSSLGATLGSALGGFGTAVANSN    631 - 700
TGSGSRRDSLTGSSDLYKRTSSSLTPIGHSFYNGLSFSSSPGPVGMPLPSQGPGHSQTPPPSLSSHGSSS    701 - 770
SLNLGGLTNGSGRYISAAPGAEAKYRSASSASSLFSPSSTLFSSSRLRYGMSDVMPSGRSRLLEDFRNNR    771 - 840
YPNLQLREIAGHIMEFSQDQHGSRFIQLKLERATPAERQLVFNEILQAAYQLMVDVFGNYVIQKFFEFGS    841 - 910
LEQKLALAERIRGHVLSLALQMYGCRVIQKALEFIPSDQQNEMVRELDGHVLKCVKDQNGNHVVQKCIEC    911 - 980
VQPQSLQFIIDAFKGQVFALSTHPYGCRVIQRILEHCLPDQTLPILEELHQHTEQLVQDQYGNYVIQHVL    981 - 1050
EHGRPEDKSKIVAEIRGNVLVLSQHKFASNVVEKCVTHASRTERAVLIDEVCTMNDGPHSALYTMMKDQY   1051 - 1120
ANYVVQKMIDVAEPGQRKIVMHKIRPHIATLRKYTYGKHILAKLEKYYMKNGVDLGPICGPPNGII       1121 - 1186
//

Text Mined References (52)

PMID Year Title
26724866 2016 Noncoding RNA NORAD Regulates Genomic Stability by Sequestering PUMILIO Proteins.
26517885 2015 Bespoke RNA recognition by Pumilios.
25768905 2015 Pumilio1 haploinsufficiency leads to SCA1-like neurodegeneration by increasing wild-type Ataxin1 levels.
25512524 2014 A divergent Pumilio repeat protein family for pre-rRNA processing and mRNA localization.
25340845 2014 A novel function of human Pumilio proteins in cytoplasmic sensing of viral infection.
25100735 2014 Post-transcriptional gene expression control by NANOS is up-regulated and functionally important in pRb-deficient cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23625657 2013 Upregulated hPuf-A promotes breast cancer tumorigenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22955276 2012 Human Pumilio proteins recruit multiple deadenylases to efficiently repress messenger RNAs.
22916034 2012 Identification of human proteins that modify misfolding and proteotoxicity of pathogenic ataxin-1.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22345517 2012 Pumilio facilitates miRNA regulation of the E2F3 oncogene.
21653694 2011 Specific and modular binding code for cytosine recognition in Pumilio/FBF (PUF) RNA-binding domains.
21572425 2011 A universal code for RNA recognition by PUF proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21397187 2011 Alternate modes of cognate RNA recognition by human PUMILIO proteins.
21269460 2011 Initial characterization of the human central proteome.
20860814 2010 A structural-based statistical approach suggests a cooperative activity of PUM1 and miR-410 in human 3'-untranslated regions.
20818387 2010 A Pumilio-induced RNA structure switch in p27-3' UTR controls miR-221 and miR-222 accessibility.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19319195 2009 A novel puf-A gene predicted from evolutionary analysis is involved in the development of eyes and primordial germ-cells.
18776931 2008 Comparative analysis of mRNA targets for human PUF-family proteins suggests extensive interaction with the miRNA regulatory system.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18411299 2008 Ribonomic analysis of human Pum1 reveals cis-trans conservation across species despite evolution of diverse mRNA target sets.
18328718 2008 Structures of human Pumilio with noncognate RNAs reveal molecular mechanisms for binding promiscuity.
18211679 2008 Identification of genes for normalization of real-time RT-PCR data in breast carcinomas.
17116749 2006 Comparative proteomics of clathrin-coated vesicles.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16429158 2006 Disrupted function and axonal distribution of mutant tyrosyl-tRNA synthetase in dominant intermediate Charcot-Marie-Tooth neuropathy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14584586 2003 The PUF family of RNA-binding proteins: does evolutionarily conserved structure equal conserved function?
12771951 2003 Genome-wide comparison of human keratinocyte and squamous cell carcinoma responses to UVB irradiation: implications for skin and epithelial cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12459267 2002 Cloning and comparative sequence analysis of PUM1 and PUM2 genes, human members of the Pumilio family of RNA-binding proteins.
12202039 2002 Modular recognition of RNA by a human pumilio-homology domain.
11336708 2001 Crystal structure of a Pumilio homology domain.
11252894 2000 Three ways to make a vesicle.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7788527 1995 Prediction of the coding sequences of unidentified human genes. III. The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1.