Property Summary

NCBI Gene PubMed Count 43
PubMed Score 25.91
PubTator Score 25.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 2.7e-10
ovarian cancer 8491 5.4e-04
lung cancer 4473 2.8e-02
Disease Target Count Z-score Confidence
Coloboma 52 3.73 1.9
Tracheal stenosis 18 3.192 1.6
Disease Target Count
Verheij syndrome 1

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.400 2.8e-02
posterior fossa group B ependymoma 1.200 2.7e-10
ovarian cancer 1.600 5.4e-04

Gene RIF (12)

PMID Text
26497854 Mutations in PUF60 gene is associated with idiopathic hypereosinophilic syndrome.
26177862 Concomitant over expression of far upstream element (FUSE) binding protein (FBP) interacting repressor (FIR) and its splice variants induce migration and invasion of non-small cell lung cancer cells.
24824848 Overexpression of far upstream element (FUSE) binding protein (FBP)-interacting repressor (FIR) supports growth of hepatocellular carcinoma.
24811221 High FBP-interacting repressor expression is associated with hepatocellular carcinoma.
24140112 Haploinsufficiency of each of SCRIB or PUF60 contribute uniquely to specific endophenotypes (e.g., coloboma, heart defects), and binary interaction potentially exacerbates other aspects of the clinical pathology of individuals with 8q24.3 deletion.
23594796 The interaction between SAP155 and FIR/FIRDeltaexon2 not only integrates cell-cycle progression and c-Myc transcription by modifying P27 and P89 expression.
23113893 Circulating FIR variant mRNA in the peripheral blood of cancer patients were significantly overexpressed compared to that in healthy volunteers.
22496461 Data indicate that altered FIR and c-myc pre-mRNA splicing, in addition to c-Myc expression by augmented FIR/FIRDeltaexon2-SAP155 complex, potentially contribute to colorectal cancer development.
20420426 FIR is monomeric in solution but dimerizes upon DNA binding; DNA-induced dimerization is mediated by FIR's RNA recognition motif.
18974054 Puf60-UHM binds to ULM sequences in the splicing factors SF1, U2AF65, and SF3b155.
17579712 study identified PUF60 as a factor that promotes splicing of an intron with a weak 3' splice-site; demonstrated that PUF60 can functionally substitute for U2AF(65)in vitro, but splicing is strongly stimulated by the presence of both proteins
16628215 Results describe the roles of the FarUpStream Element (FUSE), FUSE Binding Protein (FBP), FBP Interacting Repressor (FIR), and TFIIH in the regulation of c-myc expression.

AA Sequence

MATATIALQVNGQQGGGSEPAAAAAVVAAGDKWKPPQGTDSIKMENGQSTAAKLGLPPLTPEQQEALQKA      1 - 70
KKYAMEQSIKSVLVKQTIAHQQQQLTNLQMAAVTMGFGDPLSPLQSMAAQRQRALAIMCRVYVGSIYYEL     71 - 140
GEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQ    141 - 210
AQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSS    211 - 280
QDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPATPGGLPPAAAVAAAAATAKITAQEAVAGAAVLGTLGT    281 - 350
PGLVSPALTLAQPLGTLPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTLGLLEPKKEKE    351 - 420
EEELFPESERPEMLSEQEHMSISGSSARHMVMQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKF    421 - 490
GAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA     491 - 559
//

Text Mined References (53)

PMID Year Title
26497854 2015 Whole-exome sequencing and genome-wide methylation analyses identify novel disease associated mutations and methylation patterns in idiopathic hypereosinophilic syndrome.
26177862 2015 Concomitant expression of far upstream element (FUSE) binding protein (FBP) interacting repressor (FIR) and its splice variants induce migration and invasion of non-small cell lung cancer (NSCLC) cells.
25671302 2015 Haploinsufficiency of the c-myc transcriptional repressor FIR, as a dominant negative-alternative splicing model, promoted p53-dependent T-cell acute lymphoblastic leukemia progression by activating Notch1.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24824848 2014 Overexpression of far upstream element (FUSE) binding protein (FBP)-interacting repressor (FIR) supports growth of hepatocellular carcinoma.
24811221 2014 Alternative splicing of FBP-interacting repressor coordinates c-Myc, P27Kip1/cyclinE and Ku86/XRCC5 expression as a molecular sensor for bleomycin-induced DNA damage pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24140112 2013 SCRIB and PUF60 are primary drivers of the multisystemic phenotypes of the 8q24.3 copy-number variant.
23974796 2013 Identification of a long non-coding RNA-associated RNP complex regulating metastasis at the translational step.
23594796 2013 Interactions between SAP155 and FUSE-binding protein-interacting repressor bridges c-Myc and P27Kip1 expression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23113893 2013 SAP155-mediated c-myc suppressor far-upstream element-binding protein-interacting repressor splicing variants are activated in colon cancer tissues.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22496461 2012 SAP155-mediated splicing of FUSE-binding protein-interacting repressor serves as a molecular switch for c-myc gene expression.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
21078624 2011 Comparison of an expanded ataxia interactome with patient medical records reveals a relationship between macular degeneration and ataxia.
20420426 2010 Quantitative characterization of the interactions among c-myc transcriptional regulators FUSE, FBP, and FIR.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19273283 2009 c-myc suppressor FBP-interacting repressor for cancer diagnosis and therapy.
18974054 2009 Dimerization and protein binding specificity of the U2AF homology motif of the splicing factor Puf60.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18255255 2008 A protein-protein interaction network of transcription factors acting during liver cell proliferation.
18193062 2008 The functional response of upstream DNA to dynamic supercoiling in vivo.
18056422 2007 Human Y5 RNA specializes a Ro ribonucleoprotein for 5S ribosomal RNA quality control.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17579712 2007 Control of pre-mRNA splicing by the general splicing factors PUF60 and U2AF(65).
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16628215 2006 The FUSE/FBP/FIR/TFIIH system is a molecular machine programming a pulse of c-myc expression.
16452196 2006 An essential role of alternative splicing of c-myc suppressor FUSE-binding protein-interacting repressor in carcinogenesis.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11445587 2001 A yeast four-hybrid system identifies Cdk-activating kinase as a regulator of the XPD helicase, a subunit of transcription factor IIH.
11239393 2001 Defective interplay of activators and repressors with TFIH in xeroderma pigmentosum.
10882074 2000 The FBP interacting repressor targets TFIIH to inhibit activated transcription.
10866799 2000 A trans-acting factor, isolated by the three-hybrid system, that influences alternative splicing of the amyloid precursor protein minigene.
10668799 2000 Interaction cloning and characterization of RoBPI, a novel protein binding to human Ro ribonucleoproteins.
10606266 1999 PUF60: a novel U2AF65-related splicing activity.
10524322 1999 Identification of ribonucleoprotein (RNP)-specific protein interactions using a yeast RNP interaction trap assay (RITA).