Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.93
PubTator Score 51.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.200 1.0e-03
intraductal papillary-mucinous neoplasm ... 1.800 6.6e-03
cystic fibrosis 1.600 8.2e-06
psoriasis 1.100 4.2e-73

Gene RIF (1)

PMID Text
20722631 HDHD1 is a phosphatase specifically involved in dephosphorylation of a modified nucleotide present in RNA.

AA Sequence

MAAPPQPVTHLIFDMDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMS      1 - 70
KEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSGSASFDMKTSRHKEFFSLFSHIVLG     71 - 140
DDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLV    141 - 210
LNSLQDFQPELFGLPSYE                                                        211 - 228
//

Text Mined References (13)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20722631 2010 HDHD1, which is often deleted in X-linked ichthyosis, encodes a pseudouridine-5'-phosphatase.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
9055824 1997 Cloning and sequencing of ribosomal protein L27a and a gene similar to human GS1 in Drosophila.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1734713 1992 The human enamel protein gene amelogenin is expressed from both the X and the Y chromosomes.
1284467 1992 Isolation of a new gene from the distal short arm of the human X chromosome that escapes X-inactivation.