Property Summary

NCBI Gene PubMed Count 270
PubMed Score 8.53
PubTator Score 571.44

Knowledge Summary

Patent

No data available

Expression

Gene RIF (251)

PMID Text
26842615 Low plasma concentration of PTX3 in early pregnancy is associated with subsequent development of gestational diabetes and with an enhanced risk for CVD as estimated by an elevated apoB/apoA ratio at 5 years postpartum.
26738395 Data show that serum pentraxin-3, nitric oxide (NO) and and tumour necrosis factor-alpha (TNFalpha) were significantly increased in alcoholic cirrhosis patients compared to controls.
26650391 PTX3 plays a non-redundant role in resistance against microbial pathogens and in the regulation of inflammation. (Review)
26576501 data indicate TLR engagement induces PTX3 expression in microglia and the expression is detectable in multiple sclerosis(MS)lesions; enhanced PTX3 expression is expressed in microglia in preactive MS lesions and in microglia/macrophages engaged in myelin phagocytosis in actively demyelinating lesions; it was not detected in CSF of MS patients
26546709 In stroke patients without cardiovascular, cardiopulmonary and infectious diseases, serum pentraxin-3 levels are not associated with stroke prognosis.
26508705 Pentraxin 3 sputum levels differ in patients with chronic obstructive pulmonary disease vs asthma
26485684 Variation in PTX3 gene expression may produce even opposite effects depending on which target organ is considered and the physiopathological context. [Review]
26457877 Studies show that pentraxin 3 (PTX3) promoter and regulatory regions were highly methylated in selected human mesenchymal and epithelial tumors, in contrast to the normal counterpart.
26434104 PTX3 may be a useful biomarker for diagnosis of febrile neutropenia in patients with lung neoplasms.
26400151 Patients with hepatocellular carcinoma had higher PTX3 plasma levels compared to individuals with mild or severe fibrosis; PTX3 rs2305619 polymorphism and plasma levels were correlated with Child-Pugh scores B and C in hepatocellular carcinoma individuals
26367098 Demonstrate markedly higher PTX3 levels in NAFLD patients compared with controls, and in biopsy proven NASH patients compared with non-NASH ones.
26348770 These results support the potential of serum PTX3 as a lung cancer biomarker in high-risk subjects
26267536 Data show that human pentraxin 3 (PTX3) overexpression in transgenic mice inhibits tumor growth and angiogenesis.
26176960 PTX3 expressed in the eye cannot be detected systemically and systemic PTX3 may have little or no impact on age-related macular degeneration progression.
26124179 PTX3 is induced by chemotherapy in tumor stroma and has a role in progression of drug-resistant cancers
26070095 PTX3 levels are significantly elevated in all patients on hemodialysis, but presence and extended duration of tunneled permanent catheters are associated with incrementally higher levels of PTX3 and other inflammatory markers.
26054123 high plasma levels in pre-eclamptic patients
25982553 PTX3 is produced at the sites of inflammation, therefore it seems that elevated PTX3 may result from activation of cells involved in local urticarial processes
25977268 The authors show that PTX3 polymorphisms are independent risk factors for invasive mold infections among 1101 solid organ transplant recipients, thereby strengthening their role in mold infection pathogenesis and patients' risk stratification.
25964543 Our findings suggest that gastric cancer-derived PTX3 promotes macrophage recruitment, which may contribute to gastric cancer-related inflammation.
25920034 PTX3 was found to have a cardioprotective role in chronic Chagas disease patients.
25855355 In this study, we identify pentraxin 3 (PTX3) as a novel ligand of CFHR5
25854969 PTX3 levels were positively associated with the severity of coronary artery lesions. PTX3 is closely associated with the severity of coronary artery stenosis in patients with chronic renal dysfunction.
25832310 in children with lower respiratory tract infections, PTX-3 reflected disease severity but failed to predict length of hospital stay
25814534 patients with acute coronary syndrome had higher levels of pentraxin-3 and galectin-3; Patients with elevated levels of these biomarkers experienced higher number of deaths and had a lower mean left ventricular ejection fraction
25805362 renal expression is associated with proteinuria and interstitial fibrosis in lupus glomerulonephritis patients
25797258 Autocrine production of EGF-induced PTX3 in turn induces metastatic molecules, activating inflammatory cascades and metastasis
25774777 These data suggest that the relative levels of SAP and PTX3 present at sites of fibrosis may have a significant effect on the ability of monocytes to differentiate into fibrocytes.
25760650 These results indicated that serum and colonic expression of PTX3 were upregulated in patients with active Crohn's disease, suggesting serum PTX3 is superior to CRP in predicting Crohn's disease activity.
25747934 For the first time a direct role of PTX3 on vascular function and blood pressure homeostasis is shown, identifying the molecular mechanisms involved.
25732129 Sucrose non-fermenting AMPK related kinase/Pentraxin 3 combined role in immunometabolic signaling and DNA damage response is proposed to accelerate cardiovascular complications in systemic lupus erythematosus patients
25695775 our study identified a previously undescribed pathogenic role of PTX3 during virus infection
25679762 PTX3, an effector molecule belonging to the humoral arm of innate immunity, acts as an extrinsic oncosuppressor gene in mouse and man by regulating Complement-dependent, macrophage-sustained, tumor-promoting inflammation.
25664655 Letter: pentraxin 3 levels are up-regulated in women with fibromyalgia.
25641196 Results indicate that GDF8 down-regulates PTX3 expression via SMAD-dependent signaling in human granulosa cells suggesting a potential role for GDF8 in the regulation of follicular function.
25620175 Increased expression of PTX3 is correlated with tumor invasion of lung adenocarcinoma.
25604633 Data showed the association between the PTX3 rs3816527 gene polymorphism with susceptibility to migraine only in the male patients.
25553422 PTX3 is able to modulate the innate response to gliadin in celiac disease and it could regulate the adaptive immune response.
25550806 PTX3 could exacerbate endothelial dysfunction, at least partially, through IKK/IkappaB/NF-kappaB activation and overexpression of iNOS and NO, and advance the development of atherosclerosis.
25543194 A high PTX3 level and IgM staining in skin biopsies from Henoch-Schonlein purpura patients may be harbingers of subsequent renal involvement.
25538378 plasma pentraxin-3 levels has a prognostic role in patients with stable coronary artery disease after drug-eluting stent implantation
25530683 review of the role of Pentraxin 3 as a prognostic biomarker in patients with systemic inflammation or infection
25496843 may differentiate normal and abnormal fetal growth among women presenting at third trimester of pregnancy with a small for gestational age fetus
25491620 Elevated levels of serum PTX3 were associated with severity of illness in psoriasis patients.
25467846 Data suggest that up-regulation of plasma PTX3 by exercise is blunted in obesity; here, at baseline and after 30 min of continuous submaximal aerobic exercise, obese subjects exhibited 40% lower plasma PTX3 compared to normal-weight subjects.
25447599 This study demonistrated that POEMS activity does not influence PTX3 circulating levels.
25435748 It is possible that PTX3 can be used as a diagnostic biomarker of retinal vein occlusion.
25412085 Results showed elevated plasma PTX3 levels in patients with chronic thromboembolic pulmonary hypertension and can be used for disease detection.
25401491 PTX3 concentrations in SLE patients might serve as a indicator of the activation/dysfunction of vascular endothelium.
25394473 Arterial inflammation and progression of vascular involvement influence plasma PTX3 levels in Takayasu arteritis.
25385504 In systemic sclerosis patients, exposure to high concentrations of PTX3 may suppress endothelial progenitor cell-mediated vasculogenesis and promote vascular manifestations such as digital ulcers and pulmonary arterial hypertension.
25373851 PTX3 is also associated with other cardiovascular risk factors.
25344970 In the early phase of acute pancreatitis (AP), the concentrations of PTX3 achieved maximum earlier than CRP or SAA, enabling to differentiate between mild, moderate or severe AP in the first day of the disease.
25323314 Elevated PTX3 was an independent predictor of 30-day cardiac events and mortality.
25303877 Circulating levels of PTX3 were elevated in COPD patients.
25237185 Morning PTX3 levels reflect obstructive sleep apnea-related acute inflammation and are a useful marker for improvement in OSA following CPAP therapy.
25190808 Weak, transient cross-linking by products of the quaternary hyaluronan/inter-alpha-inhibitor/TSG-6/PTX3 interactions can simultaneously support two processes, matrix stabilization and matrix expansion.
25178940 The aim of this study was to determine the incidence and role of pentraxin-3 (PTX-3) overexpression as a predictive/prognostic marker in small-cell lung carcinoma (SCLC).
25159210 Plasma PTX3 is positively associated with diabetic retinopathy development and progression, and may be a more accurate predictor of its development than hsCRP.
25148605 Suggest pentraxin 3 could be a new diagnostic marker for excessive inflammatory response in cardiac surgery.
25131923 A positive correlation was found between the expression of PTX3 in coronary plaque and macrophage cells type 2.
25049357 Mechanistically, engagement of MD-2 by PTX3-opsonized Aspergillus conidia activated the TLR4/Toll/IL-1R domain-containing adapter inducing IFN-beta-dependent signaling pathway converging on IL-10.
25048680 PTX-3 might have an atheroprotective role as well as serving as a simple biomarker in coronary atherosclerosis.
24979323 Serum PTX3 was higher in patients with coronary artery disease compared to controls. Increased PTX3 correlated with disease severity.
24958171 Results indicate that the oligomerization state of PTX3 is an indicator of sepsis outcome as its conversion from octamer to monomer correlates with greater survival.
24950910 There was an increase in PTX3 tissue expression between the first and second prostate biopsy. PTX3 serum levels were also higher in patients with prostate cancer than in patients with inflammation/BPH.
24936646 PTX3 may be a potential novel indicator of carotid plaque vulnerability.
24745336 genetic polymorphism is associated with susceptibility to acute pyelonephritis and cystitis
24724970 There is no correlation between fetal and maternal serum levels of PTX3 in either healthy pregnancies or those complicated by preeclampsia.
24709882 Serum PTX3, MMP-9 and C-reactive protein expression was significantly higher in the acute coronary syndrome patients compared with controls.
24705587 the results do not indicate that PTX3 can predict recurrent coronary events among MI survivors.
24675235 PTX3 overexpression inhibited cholesterol efflux via activation of extracellular signal-regulated protein kinases 1 and 2, down-regulated the expression of the key cholesterol transporter, ABCA1, and nuclear transcription factors, PPARgamma and LXRalpha.
24664887 The PTX3-driven increase in the osteoclastogenic potential of precursor osteoblasts (pOB) appears to be mediated by the effect of PTX3 on pOB RANKL production.
24652286 These results indicate that PTX3 is constitutively expressed and secreted by AM cells as an integral component of the AM HC-HA-PTX3 complex and contributes to the biological function of AM HC-HA-PTX3.
24628740 PTX3 was associated with cardiovascular disease risk factors, subclinical CVD, coronary artery calcium and incident coronary heart disease events.
24613562 PTX3 is a physiological constituent of the amniotic fluid and is elevated in the presence of spontaneous preterm labor reinforcing the theory that PTX3 plays a role in innate immune response during gestational complications associated with infectious/inflammatory conditions
24568622 After a kidney transplant, pentraxin 3 may not be useful in determining inflammatory status.
24503185 Interleukin-1-induced changes in the glioblastoma secretome suggest its role in tumor progression.
24476432 Genetic deficiency of PTX3 affects the antifungal capacity of neutrophils and may contribute to the risk of invasive aspergillosis in patients treated with hematopoietic stem-cell transplantation.
24474442 Peak level of PTX3 in acute aortic dissection was associated with the amount of transient pleural fluid accumulation, which may be associated with inflammatory vascular permeability.
24462365 PTX3 plasma levels do not predict carotid intima media thickness progression and incidence of cardiovascular events in the general population
24457902 PTX3 silencing using PTX3-specific siRNA prevented breast cancer cell migration, macrophage chemotaxis, and subsequent OC formation.
24350299 The current study provided the first evidence that decreased plasma PTX3 levels are associated with T2DM and diabetic nephropathy (DN) in Malay men and also suggested that PTX3 may have different effects in DN and chronic kidney diseases.
24347428 Plasma PTX3 levels were reduced in polycystic ovary syndrome women and independently associated with hyperandrogenism and other endocrine and ovarian features of PCOS.
24333560 Plasma PTX3 level may be a useful marker for predicting post-percutaneous coronary intervention cardiac cTnT elevation, which is associated with inflammatory status of culprit lesions.
24279306 PTX3 plays a role in the fertilization process.
24273922 findings suggest that PTX3 may be useful in early evaluation and prediction of the severity of acute pancreatitis
24261762 Patients with systemic lupus erythematosus have increased concentrations of PTX3 compared with control subjects. PTX3 was significantly associated with disease activity but not with carotid atherosclerosis.
24215445 Obesity is associated with low circulating PTX3 in acute coronary syndrome. This association is also observed in the presence of abdominal fat accumulation as reflected by elevated waist circumference.
24132243 Systemic pre-PCI PTX3 was associated with high-risk plaque components and impaired post-PCI myocardial perfusion. Thus, PTX3 may be a reliable predictor of outcome in STEMI patients.
24060373 Gene expression in irradiated arteries compared to non-irradiated showed a consistent up-regulation of PTX3 in all patients and in a majority of veins.
24039869 Pentraxin-3 serum levels are associated with disease severity and mortality in patients with systemic inflammatory response syndrome.
24012697 PTX3 levels are elevated in non-ST-elevation acute coronary syndrome.
23991979 High PTX3 expression is associated with lung cancer.
23979265 Local PTX3 production in the left atrium might reflect the local inflammation of atrial fibrillation.
23954061 Systemic PTX3 levels comprise a useful inflammatory marker that reflects coronary plaque vulnerability.
23863905 Human colostrum contains high levels of PTX3. Breast epithelial cell and CD11b(+) milk cells constitutively produce PTX3. PTX3 ingested during lactation was detected in neonates and may protect against infection.
23817411 These results demonstrate that ficolin-1 and PTX3 heterocomplex formation acts as a noninflammatory "find me and eat me" signal to sequester altered-host cells.
23771016 Arterial stiffness is increased in overweight and obese individuals. The increase in arterial stiffness may, at least in part, be associated with an obesity-related reduction in plasma PTX3 concentrations
23735470 PTX3 levels were higher in SCD patients in VOC, being associated with longer hospital stay. Higher initial PTX3 concentrations were related to the development of ACS with a further increase in PTX3 levels observed upon progression to ACS.
23690668 The observations point to a cardiovascular protective effect of PTX3 associated with the ability of tuning inflammation and favor the hypothesis that the increased levels of PTX3 may reflect a protective physiological mechanism.
23664694 PTX3 expression differed across low and high-grade tumors based on histopathological diagnosis and clinical severity, positively correlating with tumor grade and severity.
23658833 Elevated circulating levels and tissue expression of PTX3 in uremia reflect endothelial dysfunction.
23643952 Plasma PTX3 levels are elevated in heart failure (HF) and might be used as diagnostic value in classification of patients with HF.
23625866 PTX3 is an anti-inflammatory mediator which essentially protects against the perils of atherosclerosis and myocardial infarction. [review]
23609129 Plasma pentraxin 3 may be a better marker of peripheral artery disease in hemodialysis patients than C-reactive protein.
23579776 higher synovial fluid levels are associated with juvenile idiopathic arthritis disease severity
23527487 This review of the general properties of PTX3 and C-reactive protein (CRP) as prototypes of long and short pentraxins, respectively, emphasizing in particular the functional role of PTX3 as a prototypic pattern recognition molecule.
23475792 increased levels in serums from cystic fibrosis patients, but low in their respiratory secretions
23443958 PTX3 is significantly associated with kidney dysfunction.
23434196 pentraxin 3 might modulate the inflammatory process involved in the pathogenesis of cardiovascular disease
23424081 Long pentraxin-3 is an epithelial-stromal fibroblast growth factor-targeting inhibitor in prostate cancer.
23401658 importance of the mitogen-activated protein kinase/extracellular signal-regulated kinase1/2 and nuclear factor kappa-light-chain-enhancer of activated B-cell pathways for regulated PTX3 expression in retinal pigment epithelial cells
23341967 A high PTX3 level on hospital admission predicts severe sepsis and case fatality in patients with suspected infection
23285251 PTX3 concentration itself is unlikely to be even a modest causal factor for acute myocardial infection but is a prognostic marker after.
23245734 Increased levels of plasma PTX3 are associated with accelerated atherosclerotic change and increased albuminuria in young patients with type 1 diabetes.
23237880 Serum pentraxin 3 levels are associated with the complexity and severity of coronary artery disease in patients with stable angina pectoris.
23235124 PTX-3 stands out as a rapid and sensitive marker of hemodialysis-induced inflammation. Membrane flux and hemodiafiltration did not alter the inflammatory response.
23182717 Data show that a photodynamic therapy (PDT) dose-dependent upregulation of CRP gene, as well as of PTX3 and ficolin 1 genes in lung tumor A549 cells, and indicate critical role played by PI3K/Akt/AP-1 pathway.
23169308 Increased PTX3 levels are associated with adverse outcomes following paracetamol-induced acute liver injury.
23100088 PTX3 and MMP-9, which are not affected by prednisolone, could be sensitive biomarkers for assessing Takayasu arteritis activity.
23062219 Data suggest that elevated maternal PTX3 plasma level is biological marker of altered endothelial function, typical of preeclampsia or intrauterine growth retardation; elevation in maternal PTX3 increases with disease severity.
23012252 Plasma PTX3 level is associated with inflammatory responses in Multiple sclerosis and neuromyelitis optica
22889492 Data suggest that plasma PTX3 is up-regulated in first trimester in pregnant women with history of recurrent miscarriage or embryo loss; in patient group, pentraxin-3 showed significant positive correlation with number of previous miscarriages.
22883522 The high expression of PTX3 in placentas from the preeclamptic patients suggests that PTX3 may be involved in the pathologic process of preeclampsia.
22847671 In multiple myeloma PTX3 behaves as an anti-angiogenic molecule and an inhibitor of cross-talk between plasma cells and endothelial cells/fibroblasts.
22834944 selective pressure on PTX3 variants that affect the innate immune response to infectious agents, could also produce the observed high incidence of DZ twinning in Gambians.
22822025 Genetic variants of PTX3 protein are associated with primary graft dysfunction after lung transplantation.
22785134 High PTX3 expression is associated with coronary atherosclerotic plaques.
22747472 High PTX3 is associated with acute renal allograft rejection.
22714118 PTX3 and TNF-alpha are increased in preeclampsia and are likely involved in the pathogenesis of preeclampsia
22687644 PTX3 is negatively associated with insulin resistance and associated with changes in insulin resistance induced by physical activity in overweight and obese children.
22617341 The plasma level of PTX3 may be a useful biomarker for predicting the tissue characteristics of coronary plaque using integrated backscatter intravascular ultrasound. Statin therapy may have a beneficial effect with regard to the reduction of PTX3 levels.
22577258 Pentraxin 3(PTX 3) is an endogenous modulator of the inflammatory response [review]
22546644 Data show in the renal transplant (RT) recipients serum Pentraxin3 (PTX3) was significantly higher than the hemodialysis (HD) patients.
22529962 PTX3 expression is increased in asthmatic airways. HASMC can both produce and respond to PTX3. PTX3 is a potent inhibitor of HASMC migration induced by FGF-2 and can upregulate CCL11/eotaxin-1 release.
22447522 Serum amyloid A (SAA) induces pentraxin 3 (PTX3) production in rheumatoid synoviocytes.
22319633 Level of PTX3 is independently associated with atherosclerosis and manifest cardiovascular disease but not early vessel pathology
22309253 PTX3 has been identified as a non-redundant protective factor against infections caused by A. fumigatus. [Review]
22304663 PTX3 level is increased in patients with polycystic ovary syndrome in concordance with insulin resistance.
22278372 AZU1 exhibited high affinity binding to PTX3 in a calcium ion-dependent manner
22267482 TSG-6 reverts the inhibitory effects exerted by PTX3 on FGF2-mediated angiogenesis through competition of FGF2/PTX3 interaction.
22178425 Higher levels of PTX3 are independently associated with increased mortality after ischemic stroke.
22123215 high PTX3 is associated with peripheral artery disease.
22072855 Data show that PTX3 expression is down-regulated in human esophageal squamous cell carcinoma due to gene promoter hypermethylation.
22053612 Levels of sPTX 3 and sIL-6 were significantly higher in RA patients than controls.
21989653 Local expression of PTX3 is a feature of vascular inflammation in giant cell arteritis.
21953577 Plasma pentraxin 3 levels could be a new biochemical marker for Parkinson's (PD)disease and may be associated with the severity of motor dysfunction and other clinical symptoms in PD patients.
21948359 The long pentraxin PTX3 is a prototypic soluble pattern recognition molecule that is produced at sites of infection and inflammation by both somatic and immune cells.
21933102 cord blood level not associated with histological chorioamnionitis
21920889 In COPD, airflow limitation and reduced transfer coefficient for carbon monoxide are associated with lower pulmonary interstitial expression of PTX3.
21915248 Human pentraxin 3 binds to the complement regulator c4b-binding protein.
21914683 Serum levels of inflammatory marker pentraxin 3 decreased during cardiac rehabilation as exercise capacity increased.
21900125 PTX3 gene expression is upregulated in visceral adipose depots in obesity, despite lower plasma PTX3 protein, and by some proinflammatory cytokines in cultured adipocytes.
21883907 Elevated PTX3 levels were associated with the development of primary graft dysfunction after lung transplantation in idiopathic pulmonary fibrosis patients
21880642 pentraxin 3 is an early predictor of complications in hematologic patients with neutropenic fever.
21796992 Lactobacillus acidophilus NCFM could induce the expression of PTX3 in Caco-2 cells.
21764903 These results identify PTX3 as a novel FGF8b antagonist endowed with antiangiogenic and antineoplastic activity with possible implications for the therapy of hormonal tumors.
21716666 this is a review of the studies on PTX3, with emphasis on pathogen recognition and cross-talk with other components of the innate immune system. [Review]
21677138 Neutrophils in patients with acute myocardial infarction release PTX3, which modulates the activatory cross-talk between activated platelets and leukocytes and possibly contributes to its cardioprotective effects.
21529268 might be a more sensitive marker for cardiovascular disease than hsCRP and TNFalpha in patients with chronic kidney disease
21501295 PTX3 protein may contribute to cell-mediated immune defense in inflamed colon tissue, and in particular in crypt abscess lesions, of patients with ulcerative colitis.
21490156 data indicate interaction of M-ficolin with PTX3 arises from its ability to bind sialylated ligands; M-ficolin-PTX3 interaction described represents a novel case of cross-talk between soluble pattern-recognition molecules
21465531 SAA up-regulates PTX3 production via FPRL1 significantly, and thus, contributes to the inflammatory pathogenesis of atherosclerosis.
21423699 PTX3 proved to be a specific independent prognostic biomarker in bacteremia.
21391986 In individuals at high risk of cardiovascular disease, the PTX3 concentration is associated with hypertension, insulin resistance, & hypercholesterolemia risk factors but not with subclinical atherosclerosis.
21389698 Uric acid and pentraxin-3 may have a role in coronary artery disease risk in patients with stage 2 and 3 kidney disease
21388349 The long pentraxin PTX3 at the crossroads between innate immunity and tissue remodelling.
21330486 Both PTX3 and soluble TWEAK levels associated with the endothelial dysfunction observed with progressive kidney failure.
21257721 Data suggest that more studies are needed to establish if PTX3 has clinical utility for lung cancer diagnosis and management.
21173097 High PTX3 is associated with Inflammation and thrombosis in essential thrombocythemia and polycythemia vera.
21112127 This study provides the first demonstration of a role for astrocytic CEBPD and the CEBPD-regulated molecule PTX3 in the accumulation of damaged neurons, which is a hallmark of AD pathogenesis.
21106539 Interaction between MBL and PTX3 led to communication between the lectin and classical complement pathways via recruitment of C1q, whereas SAP-enhanced complement activation occurs via a hitherto unknown mechanism
21072499 data suggest that endogenously expressed PTX3 plays a protective role in pathogenesis of acute lung injury and a lack of PTX3 may enhance neutrophil recruitment, cell death, activation of coagulation cascades, and inflammatory responses in the lung.
21072498 Acute increased concentrations of PTX3 found in CSF but not in plasma are related to vasopasm occurrence in subarachnoid hemorrhage.
20927127 In 172 Caucasian Cystic fibrosis patients homozygous for the F508del mutation Pseudomonas aeruginosa colonization was significantly associated only with rs2305619 SNP.
20927127 Observational study of gene-disease association. (HuGE Navigator)
20683616 PTX3 provides a paradigm for the mode of action of humoral innate immunity.
20640440 Circulating pentraxin3 and C-reactive protein significantly increased immediately after peak ergometer exercise, while they did not increase after 70% anaerobic threshold exercise.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20515753 PTX-3 in our patients with hypoxic respiratory failure is affected by the severity of the hypoxic insult and correlate with the cardio-vascular impairment
20508541 Endurance-trained individuals had higher levels of circulating PTX3 than sedentary controls. PTX3 may play a partial role in endurance exercise training-induced cardioprotection.
20430947 Antihypertensive drugs improve flow-mediated dilation and normalize proteinuria, PTX3, and sTWEAK in diabetic CKD stage I patients with hypertension.
20399512 Clinical trial of gene-disease association. (HuGE Navigator)
20391484 Coronary artery disease patients with inflammatory rheumatic disease (IRD) had higher mean serum Pentraxin3 levels than patients without IRD and healthy controls
20378410 Expression of target genes was detected in cumulus cells, with relatively low concentrations of ObR-Long. Strong mutual correlations were found between mRNA levels of leptin receptor isoforms and between the short isoforms of the leptin receptor and PTX3
20363749 long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2
20356766 in acute myocardial infarction and infectious myocarditis, pentraxin 3 is produced by macrophages, the endothelium, and, to a lesser extent, myocardiocytes, and localized in the interstitium
20134101 pentraxin 3 may have a role in obesity-induced decrease in arterial distensibility
20121391 maternal plasma PTX3 (pentraxin 3) concentration increases with advancing gestational age and is significantly elevated during labor at term and in the presence of spontaneous preterm labor or preterm rupture of membranes
20022320 Amniotic fluid pentraxin 3 appears to be a marker of intra-amniotic inflammation.
19917159 Serum PTX3 (pentraxin-3) levels were similar in febrile systemic lupus erythematosus patients with infection and flare
19913121 Observational study of gene-disease association. (HuGE Navigator)
19900712 role as a multifunctional soluble pattern recognition receptor acting as a non-redundant component of the humoral arm of innate immunity [Review]
19846603 results reported here provide the first evidence that the long pentraxin PTX3 plays a role in female fertility in humans
19846603 Observational study of gene-disease association. (HuGE Navigator)
19811281 PTX3 may represent a valuable marker for early detection and prediction of preeclampsia in patients with type 1 diabetes.
19794969 PTX3-overexpressing clones showed a powerful anti-fibroblast growth factor 2 (FGF2) activity in FGF2-dependent capillary morphogenesis.
19792835 PTX3 is a physiologic constituent of the amniotic fluid, and its median concentration is elevated in the presence of intra-amniotic infection/inflammation.
19772962 The study demonstrates a close association between PTX3 deposition and complement activation in failed arteriovenous fistula (AVF) and suggests a role for PTX3 in modulating innate immunity in the pathogenesis of AVF stenosis.
19718477 PTX3 may have a role in inflammation in acute chest pain
19632990 These results demonstrate that PTX3 and Ficolin-2 may recruit each other on pathogens.
19565609 Increase in maternal plasma PTX3 in pregnancies that subsequently develop early preeclampsia is evident from 11-13 weeks but the underlying mechanism for such an increase remains uncertain.
19396030 Determining the production and regulation of PTX3 during mechanical ventilation may be critical in preventing or reducing ventilator-induced lung injury
19389798 myelomonocytic cells and MoDC are a major source of TSG-6 and that PTX3 and TSG-6 are coregulated
19327124 showed the relationship between plasma PTX3 levels and established coronary risk factors
19273457 These results suggest that elevated serum PTX3 levels are associated with the disease severity of systemic sclerosis.
19211665 Report effect of renin angiotensin system blockade on pentraxin 3 levels in type-2 diabetic patients with proteinuria.
19164811 In these older adults, PTX3 was associated with CVD and all-cause death independent of CRP and CVD risk factors.
19131771 High serum PTX3 is associated with pulmonary fungal infections.
19079137 study shows that intracellular PTX3 translocates at the surface of late apoptotic neutrophils and acts as an 'eat-me' molecule for their recognition and capture by macrophages
19050261 A role is proposed for PTX3 in the localization of complement factor H regulatory activity to surfaces that bind PTX3, thus modulating alternative pathway activation and preventing excessive inflammatory response to tissue injury.
19014569 Plasma PTX3 levels may not only have laboratory values that differentiate NASH from non-NASH, but be a marker of the severity of hepatic fibrosis in NASH.
18703503 Cell-specific regulation of PTX3 by glucocorticoid hormones in hematopoietic and nonhematopoietic cells
18685085 Human chorionic gonadotropin-induced hormones progesterone and estrogen increase the PTX3 production by human monocytes.
18676013 Emphasis on two new players involved in regulating inflammation at the maternal-fetal interface: the long pentraxin PTX3 and the decoy receptor for inflammatory chemokines D6.
18650775 PTX3 was an early indicator of shock in patients with severe meningococcal disease that followed a pattern of induction distinct from CRP.
18571180 visceral adipose tissue production of PTX3 seems to contribute to the mechanisms underlying the development of atherosclerosis
18417746 In stage 5 chronic kidney disease and type 2 diabetes with normal renal function, pentraxin 3 was independently associated with proteinuria. Pentraxin 3 and proteinuria were associated with endothelial dysfunction in patients with type 2 diabetes.
18292565 Human PTX3 binds to influenza A virus and mediates a range of antiviral activities, including inhibition of hemagglutination, neutralization of virus infectivity and inhibition of viral neuraminidase.
18048494 Estradiol and progesterone are involved in PTX3 induction and regulation during implantation. Also, of the factors secreted by trophoblast, IL-1beta induces PTX3 in human endometrial stromal cells.
18045580 Expression of pentraxin-3 (PTX3) not only in macrophages but also in neutrophils may reflect the role of PTX3 in inflammation.
17947708 PTX3 activates a complement-dependent humoral amplification loop of the innate response to a microbial ligand
17786277 These data suggest that PTX3 protein may represent an additional and stable marker of inflammation in chronic renal failure.
17675295 PTX3 directly interacts with inter-alpha-trypsin inhibitor and has a role in hyaluronan organization and cumulus oophorus expansion
17611589 Observational study of gene-disease association. (HuGE Navigator)
17611589 findings support previous data showing that VDR SNPs modulate the risk for pulmonary tuberculosis in West Africans and suggest that variation within DC-SIGN and PTX3 also affect the disease outcome
17496115 PTX3 may have a role in atherosclerosis and cardiovascular disease in hemodialysis patients
17487767 Cardiac surgical procedures performed with cardiopulmonary bypass are associated with a more pronounced release of PTX3 immediately after operation.
17441979 This study demonstrated a significant association between CSF levels of IL-1beta, Il-6, and IFN-gamma and the severity ot EV71 brain stem encephalitis.
17424885 Innate factors PTX3 and C1q are involved in the homeostasis of nasal mucosa and the pathogenesis of nasal polyposis.
17380301 PTX3 and p66((ShcA)) mRNA levels are significantly more elevated in WBCs and in adipose tissue samples of patients with high levels of LDL compared to those with low levels.
17277044 Sources of PTX3 in the lung and the regulatory mechanisms of its expression ni acute injury and infection.
17095712 The levels of plasma PTX3 were increased in patients with arterial inflammation, especially unstable angina pectoris.
16981714 These results provided evidence of an involvement of the PTX3 sugar moiety in C1q recognition and complement activation.
16865225 PTX3 could be used as a further marker of disease activity of psoriasis.
16769728 there is an FGF2-binding domain in the N-terminal extension of PTX3 spanning the PTX3-(97-110) region
16647920 Significantly higher levels of pentraxin 3 were found in preeclampsia. Intrauterine growth restriction pregnancies showed intermediate levels between normal and preeclamptic patients.
16617159 The coordinated induction by primary, proinflammatory signals of C1q and PTX3 and their reciprocal regulation during inflammation influences the clearance of apoptotic cells by antigen-presenting cells and possibly plays a role in immune homeostasis.
16380821 Review discusses clinical significance of different levels of PTX3, its role in induction or protection from autoimmunity, and the presence of specific PTX3 autoantibodies in different autoimmune diseases.
16339571 TNF-alpha induced PTX3 expression in human lung cell lines and primary epithelial cells; knockdown of either JNK1 or JNK2 with small interfering RNA also significantly reduced the regulated PTX3 expression
16166594 PTX3 acts as a third-party agent between microbial stimuli and dying cells, contributing to limit tissue damage under inflammatory conditions and the activation of autoreactive T cells
16020751 Local PTX3 upregulation may modulate vascular smooth muscle cell activation after arterial injury
15308113 serum PTX3 levels appear elevated selectively in response to infection
15262177 We provide evidence for expression of PTX3 by vascular smooth muscle cells induced by degraded lipoproteins, which may lead to a vascular acute-phase reaction, contributing to the inflammatory pathogenesis of atherosclerosis.
14603263 The mRNA level of PTX3 was 3.5-fold higher in the melancholic group as compared to that in normal controls and in nonmelancholic depressives (n=8, all groups).
12645945 Experiments with recombinant globular head domains of human C1q A, B, and C chains indicated that C1q interacts with PTX3 via its globular head region. Binding of C1q to immobilized PTX3 induced activation of the classical complement pathway.
12538709 Detection of the long pentraxin PTX3 in mesangial cells of patients with IgA glomerulonephritis suggests its potential role in the modulation of glomerular and tubular injury.
12006411 PTX3 is produced in advanced atherosclerotic plaques principally by macrophages and endothelial cells and may contribute to the pathogenesis of atherosclerosis.
12006390 By increasing tissue factor expression, PTX3 plays a potential role in thrombogenesis and ischemic vascular disease.
12004288 Expression of PTX3 by vIL-6-stimulated Kaposi's sarcoma cell cultures

AA Sequence

MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACGQEHSEWDKLFIMLENSQMRE      1 - 70
RMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDELLQATRDAGRRLARMEGAEAQ     71 - 140
RPEEAGRALAAVLEELRQTRADLHAVQGWAARSWLPAGCETAILFPMRSKKIFGSVHPVRPMRLESFSAC    141 - 210
IWVKATDVLNKTILFSYGTKRNPYEIQLYLSYQSIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGL    211 - 280
TSLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRE    281 - 350
TGGAESCHIRGNIVGWGVTEIQPHGGAQYVS                                           351 - 381
//

Text Mined References (273)

PMID Year Title
27179743 2016 The Dual Complexity of PTX3 in Health and Disease: A Balancing Act?
26921689 2016 The pentraxins PTX3 and SAP in innate immunity, regulation of inflammation and tissue remodelling.
26842615 2016 Low circulating pentraxin 3 levels in pregnancy is associated with gestational diabetes and increased apoB/apoA ratio: a 5-year follow-up study.
26763449 2016 Mesenchymal Stromal Cell-Derived PTX3 Promotes Wound Healing via Fibrin Remodeling.
26738395 2015 Pentraxin-3 and nitric oxide as indicators of disease severity in alcoholic cirrhosis.
26650391 2016 PTX3, a humoral pattern recognition molecule at the interface between microbe and matrix recognition.
26576501 2016 Pentraxin-3 is upregulated in the central nervous system during MS and EAE, but does not modulate experimental neurological disease.
26546709 2015 Serum pentraxin-3 levels in acute stroke: No association with stroke prognosis.
26508705 2015 Pentraxin 3 sputum levels differ in patients with chronic obstructive pulmonary disease vs asthma.
26485684 2015 Brain diseases and tumorigenesis: The good and bad cops of pentraxin3.
26457877 2015 PTX3 acts as an extrinsic oncosuppressor.
26434104 2015 Pentraxin-3 as a Biomarker for Febrile Neutropenia in Patients with Lung Cancer.
26400151 2016 Genetic variation in PTX3 and plasma levels associated with hepatocellular carcinoma in patients with HCV.
26367098 2015 Plasma Pentraxin 3 Differentiates Nonalcoholic Steatohepatitis (NASH) from Non-NASH.
26356573 2015 PTX3 orchestrates tissue repair.
26348770 2016 Prognostic and diagnostic potential of local and circulating levels of pentraxin 3 in lung cancer patients.
26276571 2015 Correlation of cumulus gene expression of GJA1, PRSS35, PTX3, and SERPINE2 with oocyte maturation, fertilization, and embryo development.
26267536 2015 Long-Pentraxin 3 Derivative as a Small-Molecule FGF Trap for Cancer Therapy.
26176960 2015 Systemic and Ocular Long Pentraxin 3 in Patients with Age-Related Macular Degeneration.
26138903 2015 Honokiol ameliorates endothelial dysfunction through suppression of PTX3 expression, a key mediator of IKK/I?B/NF-?B, in atherosclerotic cell model.
26124179 2015 Targeting chemotherapy-induced PTX3 in tumor stroma to prevent the progression of drug-resistant cancers.
26070095 Relationships between plasma pentraxin 3 levels and inflammation markers patients with tunneled permanent catheter in hemodialysis.
26054123 2015 Plasma pentraxin 3 levels in preeclamptic patients.
25993733 2015 Elevations of inflammatory markers PTX3 and sST2 after resuscitation from cardiac arrest are associated with multiple organ dysfunction syndrome and early death.
25982553 2015 Pentraxin-3 as a local inflammatory marker in chronic spontaneous urticaria.
25977268 2015 PTX3 Polymorphisms and Invasive Mold Infections After Solid Organ Transplant.
25964543 2015 Pentraxin-3 Silencing Suppresses Gastric Cancer-related Inflammation by Inhibiting Chemotactic Migration of Macrophages.
25920034 2015 Is pentraxin 3 a cardiovascular marker in patients with chronic Chagas disease?
25855355 2015 Factor H-related protein 5 interacts with pentraxin 3 and the extracellular matrix and modulates complement activation.
25854969 2015 Associations between pentraxin 3 and severity of coronary artery disease.
25832310 2016 Pentraxin 3 as a clinical marker in children with lower respiratory tract infection.
25814534 2015 Value of pentraxin-3 and galectin-3 in acute coronary syndrome: a short-term prospective cohort study.
25805362 2015 PTX3, Anti-PTX3, and Anti-C1q Autoantibodies in Lupus Glomerulonephritis.
25797258 2015 PTX3 gene activation in EGF-induced head and neck cancer cell metastasis.
25774777 2015 The long pentraxin PTX3 promotes fibrocyte differentiation.
25760650 2015 Serum pentraxin 3 is a novel marker in Crohn's disease.
25747934 2015 Pentraxin 3 Induces Vascular Endothelial Dysfunction Through a P-selectin/Matrix Metalloproteinase-1 Pathway.
25732129 2016 Sucrose non-fermenting AMPK related kinase/Pentraxin 3 and DNA damage axis: a gateway to cardiovascular disease in systemic lupus erythematosus among Egyptian patients.
25695775 2015 Role of pentraxin 3 in shaping arthritogenic alphaviral disease: from enhanced viral replication to immunomodulation.
25679762 2015 PTX3 is an extrinsic oncosuppressor regulating complement-dependent inflammation in cancer.
25664655 Pentraxin 3 levels in women with fibromyalgia.
25641196 2015 Growth differentiation factor 8 down-regulates pentraxin 3 in human granulosa cells.
25620175 Knockdown of the inflammatory factor pentraxin-3 suppresses growth and invasion of lung adenocarcinoma through the AKT and NF-kappa B pathways.
25604633 2015 Association of the long pentraxin PTX3 gene polymorphism (rs3816527) with migraine in an Iranian population.
25553422 2014 Pentraxin 3 serum levels in celiac patients: evidences and perspectives.
25550806 2014 A key mediator, PTX3, of IKK/I?B/NF-?B exacerbates human umbilical vein endothelial cell injury and dysfunction.
25543194 2015 Could serum pentraxin 3 levels and IgM deposition in skin biopsies predict subsequent renal involvement in children with Henoch-Schönlein purpura?
25538378 2014 Prognostic value of plasma pentraxin-3 levels in patients with stable coronary artery disease after drug-eluting stent implantation.
25530683 2014 Pentraxin 3 as a prognostic biomarker in patients with systemic inflammation or infection.
25496843 2015 The association between pentraxin 3 in maternal circulation and pathological intrauterine fetal growth restriction.
25491620 2014 The levels of serum pentraxin3, CRP, fetuin-A, and insulin in patients with psoriasis.
25467846 2015 The impact of obesity on pentraxin 3 and inflammatory milieu to acute aerobic exercise.
25447599 2014 Pentraxin-3 and VEGF in POEMS syndrome: a 2-year longitudinal study.
25435748 2014 Elevated plasma pentraxin 3 and its association with retinal vein occlusion.
25412085 2014 Pentraxin3 in chronic thromboembolic pulmonary hypertension: a new biomarker for screening from remitted pulmonary thromboembolism.
25401491 2015 Pentraxin 3 as a biomarker of local inflammatory response to vascular injury in systemic lupus erythematosus.
25394473 2014 Systemic pentraxin-3 levels reflect vascular enhancement and progression in Takayasu arteritis.
25385504 2015 Elevated levels of pentraxin 3 in systemic sclerosis: associations with vascular manifestations and defective vasculogenesis.
25373851 Pentraxin-3 concentrations in stable coronary artery disease depend on the clinical presentation.
25344970 2014 [Diagnostic importance of pentraxins at the early phase of acute pancreatitis].
25323314 2014 Elevated plasma level of pentraxin-3 predicts in-hospital and 30-day clinical outcomes in patients with non-ST-segment elevation myocardial infarction who have undergone percutaneous coronary intervention.
25303877 2015 Pentraxin 3 as a novel biomarker of inflammation in chronic obstructive pulmonary disease.
25237185 2014 Morning pentraxin3 levels reflect obstructive sleep apnea-related acute inflammation.
25190808 2014 Incorporation of pentraxin 3 into hyaluronan matrices is tightly regulated and promotes matrix cross-linking.
25178940 2014 Pentraxin-3 as a prognostic marker in patients with small-cell lung cancer.
25159210 2014 Elevated plasma pentraxin 3 levels are associated with development and progression of diabetic retinopathy in Korean patients with type 2 diabetes mellitus.
25148605 2014 Could pentraxin 3 be a new diagnostic marker for excessive inflammatory response in cardiac surgery?
25131923 2014 PTX3: a modulator of human coronary plaque vulnerability acting by macrophages type 2.
25049357 2014 PTX3 binds MD-2 and promotes TRIF-dependent immune protection in aspergillosis.
25048680 2015 Is pentraxin 3 a biomarker, a player, or both in the context of coronary atherosclerosis and metabolic factors?
24979323 2014 Comparison of cystatin-C and pentraxin-3 in coronary atherosclerosis.
24958171 2014 Redox state of pentraxin 3 as a novel biomarker for resolution of inflammation and survival in sepsis.
24950910 2014 Pentraxin 3: a novel biomarker for predicting progression from prostatic inflammation to prostate cancer.
24936646 2014 Inflammatory biomarkers in atherosclerosis: pentraxin 3 can become a novel marker of plaque vulnerability.
24745336 2014 The humoral pattern recognition molecule PTX3 is a key component of innate immunity against urinary tract infection.
24724970 2014 Feto-maternal correlation of PTX3, sFlt-1 and PlGF in physiological and pre-eclamptic pregnancies.
24709882 2014 Pentraxin 3, long expression in mononuclear cells of patients with acute coronary syndrome: Correlation with C-reactive protein and matrix metalloproteinase-9 levels.
24705587 2014 Plasma pentraxin 3 levels do not predict coronary events but reflect metabolic disorders in patients with coronary artery disease in the CARE trial.
24675235 2014 Pentraxin 3 promotes oxLDL uptake and inhibits cholesterol efflux from macrophage-derived foam cells.
24664887 2014 PTX3 stimulates osteoclastogenesis by increasing osteoblast RANKL production.
24652286 2014 Constitutive expression of pentraxin 3 (PTX3) protein by human amniotic membrane cells leads to formation of the heavy chain (HC)-hyaluronan (HA)-PTX3 complex.
24628740 2014 Associations of pentraxin 3 with cardiovascular disease: the Multi-Ethnic Study of Atherosclerosis.
24613562 2014 Pentraxin-3 concentration in the amniotic fluid of women at term, in spontaneous preterm labor and when not in labor.
24568622 2014 Pentraxin 3 and C-reactive protein as inflammatory markers after a kidney transplant.
24503185 2014 Interleukin-1-induced changes in the glioblastoma secretome suggest its role in tumor progression.
24476432 2014 Genetic PTX3 deficiency and aspergillosis in stem-cell transplantation.
24474442 2015 Implications of pentraxin 3 levels in patients with acute aortic dissection.
24462365 2014 Pentraxin 3 (PTX3) plasma levels and carotid intima media thickness progression in the general population.
24457902 2014 Elevated Pentraxin 3 in bone metastatic breast cancer is correlated with osteolytic function.
24350299 2013 Evaluation of the association of plasma pentraxin 3 levels with type 2 diabetes and diabetic nephropathy in a Malay population.
24347428 2014 Plasma levels of pentraxin-3, an inflammatory protein involved in fertility, are reduced in women with polycystic ovary syndrome.
24333560 2014 Clinical value of plasma pentraxin 3 levels for predicting cardiac troponin elevation after percutaneous coronary intervention.
24279306 2013 RUNX2, GPX3 and PTX3 gene expression profiling in cumulus cells are reflective oocyte/embryo competence and potentially reliable predictors of embryo developmental competence in PCOS patients.
24273922 2013 Plasma pentraxin 3 concentrations in patients with acute pancreatitis.
24261762 2014 Pentraxin 3 is associated with disease activity but not atherosclerosis in patients with systemic lupus erythematosus.
24215445 2013 Obesity and high waist circumference are associated with low circulating pentraxin-3 in acute coronary syndrome.
24132243 2014 Relationships of elevated systemic pentraxin-3 levels with high-risk coronary plaque components and impaired myocardial perfusion after percutaneous coronary intervention in patients with ST-elevation acute myocardial infarction.
24060373 2013 Increased long-term expression of pentraxin 3 in irradiated human arteries and veins compared to internal controls from free tissue transfers.
24039869 2013 Pentraxin-3 serum levels are associated with disease severity and mortality in patients with systemic inflammatory response syndrome.
24012697 2013 Clinical and prognostic implications of circulating pentraxin 3 levels in non ST-elevation acute coronary syndrome.
23991979 2013 Clinical significance and prognostic value of pentraxin-3 as serologic biomarker for lung cancer.
23979265 2014 Pentraxin 3 is a local inflammatory marker in atrial fibrillation.
23954061 2013 Elevated levels of systemic pentraxin 3 are associated with thin-cap fibroatheroma in coronary culprit lesions: assessment by optical coherence tomography and intravascular ultrasound.
23863905 2013 Prototypic long pentraxin PTX3 is present in breast milk, spreads in tissues, and protects neonate mice from Pseudomonas aeruginosa lung infection.
23817411 2013 Ficolin-1-PTX3 complex formation promotes clearance of altered self-cells and modulates IL-8 production.
23771016 2013 Association of plasma pentraxin 3 with arterial stiffness in overweight and obese individuals.
23735470 2014 Plasma PTX3 levels in sickle cell disease patients, during vaso occlusion and acute chest syndrome (data from Saudi population).
23690668 2013 Long pentraxin 3: experimental and clinical relevance in cardiovascular diseases.
23664694 2013 The long pentraxin PTX3 as a correlate of cancer-related inflammation and prognosis of malignancy in gliomas.
23658833 2013 Elevated circulating levels and tissue expression of pentraxin 3 in uremia: a reflection of endothelial dysfunction.
23643952 2013 The role of pentraxin 3 as diagnostic value in classification of patients with heart failure.
23625866 2013 The long pentraxin PTX3: a candidate anti-inflammatory mediator in cardiac surgery.
23609129 2013 Plasma pentraxin 3 may be a better marker of peripheral artery disease in hemodialysis patients than C-reactive protein.
23579776 2013 Pentraxin 3 is a marker of early joint inflammation in patients with juvenile idiopathic arthritis.
23544079 2013 Serum amyloid P is a sialylated glycoprotein inhibitor of influenza A viruses.
23527487 2013 The long pentraxin PTX3: a paradigm for humoral pattern recognition molecules.
23475792 2013 Proteolytic cleavage of the long pentraxin PTX3 in the airways of cystic fibrosis patients.
23443958 2013 Biology of human pentraxin 3 (PTX3) in acute and chronic kidney disease.
23434196 Pentraxin 3, a novel cardiovascular biomarker, is expressed in aortic specimens of patients with coronary artery disease with and without rheumatoid arthritis.
23424081 2013 Long pentraxin-3 as an epithelial-stromal fibroblast growth factor-targeting inhibitor in prostate cancer.
23401658 2013 Human retinal pigment epithelial cells express the long pentraxin PTX3.
23341967 2013 Pentraxin 3 (PTX3) is associated with severe sepsis and fatal disease in emergency room patients with suspected infection: a prospective cohort study.
23285251 2012 Influence of pentraxin 3 (PTX3) genetic variants on myocardial infarction risk and PTX3 plasma levels.
23245734 2013 Plasma pentraxin 3 levels are associated with carotid IMT in type 1 diabetic patients.
23237880 2013 Serum pentraxin 3 levels are associated with the complexity and severity of coronary artery disease in patients with stable angina pectoris.
23235124 2012 Pentraxin 3, a sensitive early marker of hemodialysis-induced inflammation.
23182717 2013 Upregulation of genes for C-reactive protein and related pentraxin/complement proteins in photodynamic therapy-treated human tumor cells: enrolment of PI3K/Akt and AP-1.
23169308 2013 Elevated levels of the long pentraxin 3 in paracetamol-induced human acute liver injury.
23100088 2013 Diagnosis and assessment of Takayasu arteritis by multiple biomarkers.
23062219 2012 PTX3 as a potential endothelial dysfunction biomarker for severity of preeclampsia and IUGR.
23012252 2013 Increased plasma levels of pentraxin 3 in patients with multiple sclerosis and neuromyelitis optica.
22889492 2012 First trimester assessment of pentraxin-3 levels in women with primary unexplained recurrent pregnancy loss.
22883522 2012 [Expression of pentraxin-3 in placentas and its relationship with severe preeclampsia].
22847671 2013 Pentraxin 3 (PTX3) inhibits plasma cell/stromal cell cross-talk in the bone marrow of multiple myeloma patients.
22834944 2012 PTX3 genetic variation and dizygotic twinning in the Gambia: could pleiotropy with innate immunity explain common dizygotic twinning in Africa?
22822025 2012 Variation in PTX3 is associated with primary graft dysfunction after lung transplantation.
22785134 2012 Different distribution of pentraxin 3 and C-reactive protein in coronary atherosclerotic plaques.
22747472 2012 Pentraxin-3 expression in acute renal allograft rejection.
22714118 2012 The expression of pentraxin 3 and tumor necrosis factor-alpha is increased in preeclamptic placental tissue and maternal serum.
22687644 2012 The association between pentraxin 3 and insulin resistance in obese children at baseline and after physical activity intervention.
22617341 2012 Plasma pentraxin-3 levels are associated with coronary plaque vulnerability and are decreased by statin.
22577258 2012 Pentraxin 3(PTX 3): an endogenous modulator of the inflammatory response.
22546644 2012 Serum Fetuin-A and Pentraxin3 in hemodialysis and renal transplant patients.
22529962 2012 Pentraxin 3 (PTX3) expression in allergic asthmatic airways: role in airway smooth muscle migration and chemokine production.
22447522 2013 Serum amyloid A (SAA) induces pentraxin 3 (PTX3) production in rheumatoid synoviocytes.
22319633 2012 Pentraxin-3 as a marker of advanced atherosclerosis results from the Bruneck, ARMY and ARFY Studies.
22309253 2012 Current understanding of PTX3 protective activity on Aspergillus fumigatus infection.
22304663 2012 High plasma level of long Pentraxin 3 is associated with insulin resistance in women with polycystic ovary syndrome.
22278372 2012 The proteomic profile of circulating pentraxin 3 (PTX3) complex in sepsis demonstrates the interaction with azurocidin 1 and other components of neutrophil extracellular traps.
22267482 2012 Long pentraxin 3/tumor necrosis factor-stimulated gene-6 interaction: a biological rheostat for fibroblast growth factor 2-mediated angiogenesis.
22178425 2012 Pentraxin 3: a novel and independent prognostic marker in ischemic stroke.
22123215 2012 Number of endothelial progenitor cells in peripheral artery disease as a marker of severity and association with pentraxin-3, malondialdehyde-modified low-density lipoprotein and membrane type-1 matrix metalloproteinase.
22072855 2011 Aberrant methylation of the 3q25 tumor suppressor gene PTX3 in human esophageal squamous cell carcinoma.
22053612 2010 Serum pentraxin 3 and interleukin-6 are associated with subclinical atherosclerosis in recent-onset rheumatoid arthritis.
21989653 2012 Selective up-regulation of the soluble pattern-recognition receptor pentraxin 3 and of vascular endothelial growth factor in giant cell arteritis: relevance for recent optic nerve ischemia.
21953577 2011 Increases of pentraxin 3 plasma levels in patients with Parkinson's disease.
21948359 2012 Pentraxins in humoral innate immunity.
21933102 2011 Umbilical cord blood concentration of soluble scavenger receptor for hemoglobin, but not pentraxin 3, is of value for the early postpartum identification of the presence of histological chorioamnionitis.
21920889 2012 COPD is associated with reduced pulmonary interstitial expression of pentraxin-3.
21915248 2011 Human pentraxin 3 binds to the complement regulator c4b-binding protein.
21914683 2012 Cardiac rehabilitation decreases plasma pentraxin 3 in patients with cardiovascular diseases.
21900125 2011 Plasma PTX3 protein levels inversely correlate with insulin secretion and obesity, whereas visceral adipose tissue PTX3 gene expression is increased in obesity.
21883907 2011 Elevated plasma long pentraxin-3 levels and primary graft dysfunction after lung transplantation for idiopathic pulmonary fibrosis.
21880642 2011 High pentraxin 3 level predicts septic shock and bacteremia at the onset of febrile neutropenia after intensive chemotherapy of hematologic patients.
21796992 2011 [Expression of PTX3 gene in Caco-2 cells treated with Lactobacillus acidophilus NCFM].
21764903 2011 Long pentraxin-3 inhibits FGF8b-dependent angiogenesis and growth of steroid hormone-regulated tumors.
21716666 2011 Pathogen recognition by the long pentraxin PTX3.
21677138 2011 Early and transient release of leukocyte pentraxin 3 during acute myocardial infarction.
21529268 2011 Associations of plasma pentraxin 3 and monocyte chemoattractant protein-1 concentrations with cardiovascular disease in patients with chronic kidney disease.
21501295 2011 Long pentraxin 3 (PTX3) expression and release by neutrophils in vitro and in ulcerative colitis.
21490156 2011 M-ficolin interacts with the long pentraxin PTX3: a novel case of cross-talk between soluble pattern-recognition molecules.
21465531 2011 PTX3, a key component of innate immunity, is induced by SAA via FPRL1-mediated signaling in HAECs.
21423699 2011 High plasma level of long pentraxin 3 (PTX3) is associated with fatal disease in bacteremic patients: a prospective cohort study.
21391986 2011 Pentraxin 3 (PTX3) is associated with cardiovascular risk factors: the Health 2000 Survey.
21389698 2011 Uric acid and pentraxin-3 levels are independently associated with coronary artery disease risk in patients with stage 2 and 3 kidney disease.
21388349 2011 The long pentraxin PTX3 at the crossroads between innate immunity and tissue remodelling.
21330486 2011 Soluble TWEAK and PTX3 in nondialysis CKD patients: impact on endothelial dysfunction and cardiovascular outcomes.
21257721 2011 Pentraxin-3 is a novel biomarker of lung carcinoma.
21173097 2011 Inflammation and thrombosis in essential thrombocythemia and polycythemia vera: different role of C-reactive protein and pentraxin 3.
21112127 2012 CCAAT/enhancer binding protein delta (CEBPD) elevating PTX3 expression inhibits macrophage-mediated phagocytosis of dying neuron cells.
21106539 2011 Heterocomplexes of mannose-binding lectin and the pentraxins PTX3 or serum amyloid P component trigger cross-activation of the complement system.
21072499 2011 Long pentraxin PTX3 deficiency worsens LPS-induced acute lung injury.
21072498 2011 Cerebrospinal fluid pentraxin 3 early after subarachnoid hemorrhage is associated with vasospasm.
20927127 2010 PTX3 genetic variations affect the risk of Pseudomonas aeruginosa airway colonization in cystic fibrosis patients.
20683616 2011 Pentraxins in innate immunity: lessons from PTX3.
20640440 2010 Pentraxin3 and high-sensitive C-reactive protein are independent inflammatory markers released during high-intensity exercise.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20515753 2010 Pentraxin-3 in late-preterm newborns with hypoxic respiratory failure.
20508541 2011 Plasma pentraxin 3 concentration increases in endurance-trained men.
20430947 2010 Combined therapy with renin-angiotensin system and calcium channel blockers in type 2 diabetic hypertensive patients with proteinuria: effects on soluble TWEAK, PTX3, and flow-mediated dilation.
20399512 2010 Nontuberculous mycobacterial cervicofacial lymphadenitis in children from the multicenter, randomized, controlled trial in The Netherlands: relevance of polymorphisms in candidate host immunity genes.
20391484 2010 Increased levels of serum pentraxin 3, a novel cardiovascular biomarker, in patients with inflammatory rheumatic disease.
20378410 2010 Expression of leptin receptor mRNA in cumulus cells is correlated with expression of PTX3.
20363749 2010 The angiogenic inhibitor long pentraxin PTX3 forms an asymmetric octamer with two binding sites for FGF2.
20356766 PTX3 expression in the heart tissues of patients with myocardial infarction and infectious myocarditis.
20134101 2010 Is pentraxin 3 involved in obesity-induced decrease in arterial distensibility?
20121391 2010 Pentraxin 3 in maternal circulation: an association with preterm labor and preterm PROM, but not with intra-amniotic infection/inflammation.
20022320 2010 Pentraxin 3 in amniotic fluid as a marker of intra-amniotic inflammation in women with preterm premature rupture of membranes.
19917159 Serum levels of soluble triggering receptor expressed on myeloid cells-1 (sTREM-1) and pentraxin 3 (PTX3) as markers of infection in febrile patients with systemic lupus erythematosus.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19900712 2009 The soluble pattern recognition receptor pentraxin-3 in innate immunity, inflammation and fertility.
19846603 2010 Genetic variation in pentraxin (PTX) 3 gene associates with PTX3 production and fertility in women.
19811281 2009 Elevation of plasma levels of the long pentraxin 3 precedes preeclampsia in pregnant patients with type 1 diabetes.
19794969 2009 Systemic sclerosis-endothelial cell antiangiogenic pentraxin 3 and matrix metalloprotease 12 control human breast cancer tumor vascularization and development in mice.
19792835 2010 Pentraxin 3 in amniotic fluid: a novel association with intra-amniotic infection and inflammation.
19772962 2010 Pentraxin 3 and complement cascade activation in the failure of arteriovenous fistula.
19718477 2009 The long pentraxin 3 (PTX3): a novel prognostic inflammatory marker for mortality in acute chest pain.
19632990 2009 Synergy between ficolin-2 and pentraxin 3 boosts innate immune recognition and complement deposition.
19565609 2009 Maternal plasma pentraxin 3 at 11 to 13 weeks of gestation in hypertensive disorders of pregnancy.
19396030 2009 Mechanical stretch induces pentraxin 3 release by alveolar epithelial cells in vitro.
19389798 2009 Coregulation in human leukocytes of the long pentraxin PTX3 and TSG-6.
19327124 2009 Determination of physiological plasma pentraxin 3 (PTX3) levels in healthy populations.
19273457 2009 Increased serum pentraxin 3 in patients with systemic sclerosis.
19211665 2009 Effect of renin angiotensin system blockade on pentraxin 3 levels in type-2 diabetic patients with proteinuria.
19164811 2009 Associations of pentraxin 3 with cardiovascular disease and all-cause death: the Cardiovascular Health Study.
19131771 2008 PTX3 as a potential novel tool for the diagnosis and monitoring of pulmonary fungal infections in immuno-compromised pediatric patients.
19079137 2009 Endogenous PTX3 translocates at the membrane of late apoptotic human neutrophils and is involved in their engulfment by macrophages.
19050261 2008 Binding of the long pentraxin PTX3 to factor H: interacting domains and function in the regulation of complement activation.
19014569 2008 Plasma Pentraxin3 is a novel marker for nonalcoholic steatohepatitis (NASH).
18703503 2008 Cell-specific regulation of PTX3 by glucocorticoid hormones in hematopoietic and nonhematopoietic cells.
18685085 2008 Chorionic gonadotropin up-regulates long pentraxin 3 expression in myeloid cells.
18676013 2008 Inflammatory reaction and implantation: the new entries PTX3 and D6.
18650775 2009 Pentraxin 3 and C-reactive protein in severe meningococcal disease.
18571180 2009 Expression of long pentraxin PTX3 in human adipose tissue and its relation with cardiovascular risk factors.
18417746 2008 Novel links between the long pentraxin 3, endothelial dysfunction, and albuminuria in early and advanced chronic kidney disease.
18292565 2008 Antiviral activity of the long chain pentraxin PTX3 against influenza viruses.
18223257 2008 Structural characterization of PTX3 disulfide bond network and its multimeric status in cumulus matrix organization.
18048494 2008 The long pentraxin PTX3 in human endometrium: regulation by steroids and trophoblast products.
18045580 2007 Lipopolysaccharide induced expression of pentraxin 3 in human neutrophils and monocyte-derived macrophages.
17947708 2007 Complement dependent amplification of the innate response to a cognate microbial ligand by the long pentraxin PTX3.
17786277 2007 Inflammatory status in patients with chronic renal failure: the role of PTX3 and pro-inflammatory cytokines.
17675295 2007 PTX3 interacts with inter-alpha-trypsin inhibitor: implications for hyaluronan organization and cumulus oophorus expansion.
17611589 2007 DC-SIGN (CD209), pentraxin 3 and vitamin D receptor gene variants associate with pulmonary tuberculosis risk in West Africans.
17496115 2007 Pentraxin 3 is elevated in haemodialysis patients and is associated with cardiovascular disease.
17487767 2007 The long pentraxin 3 in cardiac surgery: distinct responses in "on-pump" and "off-pump" patients.
17441979 2007 Cerebrospinal fluid cytokines in enterovirus 71 brain stem encephalitis and echovirus meningitis infections of varying severity.
17424885 Innate responses to Aspergillus: role of C1q and pentraxin 3 in nasal polyposis.
17380301 2007 Relation between the plasma levels of LDL-cholesterol and the expression of the early marker of inflammation long pentraxin PTX3 and the stress response gene p66ShcA in pacemaker-implanted patients.
17277044 2007 Long pentraxin 3 in pulmonary infection and acute lung injury.
17095712 2007 Establishment of a high sensitivity plasma assay for human pentraxin3 as a marker for unstable angina pectoris.
16981714 2006 Structure and function of the long pentraxin PTX3 glycosidic moiety: fine-tuning of the interaction with C1q and complement activation.
16865225 2006 Long pentraxin 3: a marker of inflammation in untreated psoriatic patients.
16769728 2006 Identification of an antiangiogenic FGF2-binding site in the N terminus of the soluble pattern recognition receptor PTX3.
16647920 2006 Elevated maternal levels of the long pentraxin 3 (PTX3) in preeclampsia and intrauterine growth restriction.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16617159 2006 The tissue pentraxin PTX3 limits C1q-mediated complement activation and phagocytosis of apoptotic cells by dendritic cells.
16380821 2005 Protective molecules--C-reactive protein (CRP), serum amyloid P (SAP), pentraxin3 (PTX3), mannose-binding lectin (MBL), and apolipoprotein A1 (Apo A1), and their autoantibodies: prevalence and clinical significance in autoimmunity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16339571 2005 TNFalpha-induced long pentraxin PTX3 expression in human lung epithelial cells via JNK.
16166594 2006 The pattern recognition receptor PTX3 is recruited at the synapse between dying and dendritic cells, and edits the cross-presentation of self, viral, and tumor antigens.
16020751 2005 Pentraxin 3 inhibits fibroblast growth factor 2-dependent activation of smooth muscle cells in vitro and neointima formation in vivo.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15308113 2004 Selective induction of pentraxin 3, a soluble innate immune pattern recognition receptor, in infectious episodes in patients with haematological malignancy.
15262177 2004 Modified atherogenic lipoproteins induce expression of pentraxin-3 by human vascular smooth muscle cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14603263 2004 Differential expression of pentraxin 3 in fibroblasts from patients with major depression.
14515272 2003 Production of the soluble pattern recognition receptor PTX3 by myeloid, but not plasmacytoid, dendritic cells.
12763682 2003 Pentraxin 3, a non-redundant soluble pattern recognition receptor involved in innate immunity.
12645945 2003 Biochemical and functional characterization of the interaction between pentraxin 3 and C1q.
12611905 2003 Characterization of the long pentraxin PTX3 as a TNFalpha-induced secreted protein of adipose cells.
12538709 2003 The long pentraxin PTX3 is synthesized in IgA glomerulonephritis and activates mesangial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11762945 2001 PTX3 in small-vessel vasculitides: an independent indicator of disease activity produced at sites of inflammation.
10931803 2000 PTX3, A prototypical long pentraxin, is an early indicator of acute myocardial infarction in humans.
9521058 1998 Interferon-gamma inhibits expression of the long pentraxin PTX3 in human monocytes.
9407058 1997 Multimer formation and ligand recognition by the long pentraxin PTX3. Similarities and differences with the short pentraxins C-reactive protein and serum amyloid P component.
9119472 1997 Expression of a long pentraxin, PTX3, by monocytes exposed to the mycobacterial cell wall component lipoarabinomannan.
8131794 1993 IL-1 inducible genes in human umbilical vein endothelial cells.
7949102 1994 Inducible expression of PTX3, a new member of the pentraxin family, in human mononuclear phagocytes.
7679696 1993 TSG-14, a tumor necrosis factor- and IL-1-inducible protein, is a novel member of the pentaxin family of acute phase proteins.
7523502 1994 Relationship of TSG-14 protein to the pentraxin family of major acute phase proteins.
1730767 1992 A novel secretory tumor necrosis factor-inducible protein (TSG-6) is a member of the family of hyaluronate binding proteins, closely related to the adhesion receptor CD44.
1429570 1992 Interleukin-1-inducible genes in endothelial cells. Cloning of a new gene related to C-reactive protein and serum amyloid P component.