Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.76
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2716 1.4e-10
breast carcinoma 1638 4.4e-06
psoriasis 6694 6.0e-03
Breast cancer 3578 4.0e-02
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0

Gene RIF (2)

AA Sequence

MATLIYVDKEIGEPGTRVAAKDVLKLESRPSIKALDGISQVLTRRFGKTYDAPSALPKATRKALGTVNRA      1 - 70
TEKSVKTNGPRKQKQPSFSAKKMTEKTVKTKSSVPASDDAYPEIEKFFPFNLLDFESFDLPEERQIAHLP     71 - 140
LSGVPLMILDEEGELEKLFQLGPPSPVKMPSPPWECNLLQSPSSILSTLDVELPAVCYDIDI            141 - 202
//

Text Mined References (9)

PMID Year Title