Property Summary

NCBI Gene PubMed Count 29
PubMed Score 9.13
PubTator Score 94.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute myeloid leukemia 1.200 5.4e-03
astrocytic glioma 1.700 2.2e-02
Astrocytoma, Pilocytic 1.300 2.8e-08
dermatomyositis 1.100 9.6e-03
diabetes mellitus -1.100 4.8e-03
Down syndrome 1.600 2.1e-04
Duchenne muscular dystrophy 1.043 3.1e-07
glioblastoma 1.300 2.1e-03
intraductal papillary-mucinous neoplasm ... 1.600 1.5e-02
juvenile dermatomyositis 1.240 8.2e-13
Multiple myeloma 1.021 1.4e-02
oligodendroglioma 1.400 4.0e-02
ovarian cancer -1.600 5.1e-06
pancreatic cancer 1.100 1.3e-05
Waldenstrons macroglobulinemia 1.083 6.3e-04

 GO Function (1)

Gene RIF (14)

AA Sequence

MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYP      1 - 70
VTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMRER     71 - 140
EERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN                                  141 - 180
//

Text Mined References (29)

PMID Year Title