Property Summary

NCBI Gene PubMed Count 176
PubMed Score 244.32
PubTator Score 316.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
psoriasis 1.700 7.3e-164
glioblastoma 1.900 5.9e-03
osteosarcoma -1.835 4.8e-02
group 3 medulloblastoma 2.100 6.6e-05
atypical teratoid/rhabdoid tumor 1.600 1.5e-06
medulloblastoma, large-cell 1.700 4.0e-04
primitive neuroectodermal tumor 1.800 4.0e-04
Atopic dermatitis 1.600 5.8e-05
adrenocortical carcinoma 2.830 3.7e-07
non-small cell lung cancer 2.487 1.4e-26
intraductal papillary-mucinous carcinoma... 2.700 1.8e-04
intraductal papillary-mucinous neoplasm ... 3.100 1.0e-03
lung cancer 4.100 5.9e-06
colon cancer 1.300 7.1e-04
pancreatic cancer 1.300 5.7e-05
breast carcinoma 2.400 8.2e-07
pediatric high grade glioma 1.500 2.4e-04
primary Sjogren syndrome 1.200 1.1e-02
lung adenocarcinoma 2.100 9.4e-10
Endometriosis 1.449 1.5e-02
Breast cancer 3.200 3.6e-09
ductal carcinoma in situ 2.100 1.5e-03
invasive ductal carcinoma 2.300 1.6e-04
ovarian cancer 2.200 6.0e-09

 GWAS Trait (1)

Gene RIF (153)

PMID Text
26900962 knockdown of PTTG1 increased expression of integrin alpha 4 (ITGA4), ITGA5, and integrin beta 1 (ITGB1); otherwise, RhoA expression was significantly decreased
26824458 Pttg1 may increase BC cell growth through nuclear exclusion of p27, which highlights a novel molecular regulatory machinery in tumorigenesis of BC.
26710612 PTTG1 enhances HBV replication through suppression of P53.
26516926 Data show that overexpression of c-myc proto-oncogene protein could prevent the metabolic shift induced by pituitary tumor-transforming gene (PTTG) knockwown.
26445238 Data show that pituitary tumor-transforming 1 protein (PTTG1) is over-expressed in multiple myeloma (MM) patients and is associated with poor survival.
26320179 Report feedback loop between PTTG1 targeting miRNAs, PTTG1 and p53 that promotes pituitary tumorigenesis.
26264222 FoxM1 binds to PTTG1 promoter to enhance PTTG1 transcription, and FoxM1-PTTG1 pathway promotes colorectal cancer migration and invasion
25908389 Silencing of PTTG could also inhibit tumor growth, invasion, and angiogenesis in vivo. Our data indicated that PTTG might be a potential target for glioma treatment
25877755 our data suggest that Pttg1 may increase CC cell metastasis, which is negatively regulated by miR-494
25874498 we demonstrated here the inhibitory effect of CACP on the growth of H22 cells in vitro and in vivo, which may be through, at least partly, repression of PTTG1 and then followed by the inactivation of P13/Akt and activation of p38 MARK signaling pathways
25871022 PTTG1 is differentially expressed by benign and malignant pheochromocytoma with low sensitivity; meaning that positive immunohistochemistry result for PTTG1 is of great value to predict malignant behavior of pheochromocytoma
25739119 SP17/AKAP4/PTTG1 are expressed in both human NSCLC cell lines and primary tumors and can elicit an immunogenic response in lung cancer patients.
25549700 PTTG1 is a marker for proliferative skin diseases associated with cell cycle regulation and may aid in detection of aggressive cancers
25227666 Pttg1 overexpression increases the proliferation of breast cancer cells in vitro and in vivo.
24908230 This study demonstrated that PTTG was expressed in most of meningioma tissues, and the degree of PTTG immunostaining was variable in the subtypes of tumors
24879625 Data indicate that pituitary tumor-transforming gene 1 (PTTG1) was frequently overexpressed in oral squamous cell carcinoma (OSCC) tissues.
24853182 high Cdc20 and securin immunoexpression identified a patient subgroup with extremely short, on average 2.4 years, breast cancer survival and triple-negative breast cancer subtype.
24816985 The interaction between TERT and PTTG1 by association of Ku70 might be important for the enhancement of the limited self-renewal activity of MSCs and for understanding the regulatory mechanisms of self-renewal.
24754453 In peripheral area of testicular seminoma, PTTG1 staining was located in cell nucleus. In central area, staining was more intense in cytoplasm. On the other hand, in embryonal carcinoma, cells had diffuse positive staining, mainly in cytoplasm.
24627133 our data suggest that PTTG1 promotes the proliferation of prostate cancer cells via the inhibition of SMAD3. SMAD3 thus appears to be a novel therapeutic target for suppressing the growth of prostate cancer.
24594688 This present meta-analysis suggests that PTTG expression may be associated with tumor invasiveness and microvessel density of pituitary adenomas.
24377512 The numbers of migrating cells (51.38 +/- 4.71) in the PTTG siRNA group was obviously lower.
24314023 findings suggest that PTTG1 may act as a major target of miR-655. This study improves our understanding of the mechanisms underlying ESCC pathogenesis
24238056 Overexpression of PTTG1, which encodes securin, a negative regulator of p53, was identified as a marker of poor survival in adrenocortical carcinoma.
24176776 PTTG may contribute to the malignant progression of esophageal squamous cell carcinoma (ESCC) and serve as a novel prognostic indicator for patients with ESCC.
24051510 No TTF1 or EAP1 germline mutations were associated with central pubertal disorders. TTF1 and EAP1 may affect puberty by changing expression in response to other members of puberty-associated gene networks
23977008 KLF6 directly binds and represses PTTG1 expression during induction of myeloid differentiation.
23867215 These results define hPTTG as having a central role in thyroid autocrine signaling mechanisms via growth factors, with profound implications for promotion of transformed cell growth.
23850618 RNF213 R4810K reduced angiogenic activities of iPSECs from patients with MMD, suggesting that it is a promising in vitro model for MMD.
23798554 Mutation of the homologous position in PTTG1 (H(134)) switched PTTG1 from an inhibitor into an activator of ESP1.
23755904 Low cdc27 and high securin expression predict short survival for breast cancer patients.
23677169 Enhanced expression of PTTG1 in the psoriatic epidermis may result in aberrant regulation of the cell cycle and impaired differentiation via the interplay between PTTG1 and TNF-alpha.
23671127 This study identified both PTTG1 and miR-186 as potential anti-invasion targets for therapeutic intervention in non-small cell lung cancer .
23527717 PTTG1 and TAGLN2 are highly expressed in human pancreatic cancer, and the positive expression of PTTG1 is associated with the gender of cancer patients, suggesting that it may represent a potential therapeutic target for the treatment of pancreatic cancer
23523951 the presence of securin promotes resistance to gefitinib-induced apoptosis via an EGFR-independent pathway in human cancer cells
23489647 To investigate the potential roles of PTTG1 in epidermal carcinogenesis and progression, the expression of PTTG1 was analysed by immunohistochemistry along with Ki67, keratin 10 (K10) and p53 in tissue samples of cutaneous squamous cell carcinomas.
23416975 STAT3 induces PTTG expression to facilitate tumor growth and metastasis.
23404407 Expression levels of PTTG and PCNA in invasive pituitary adenomas were significantly higher than in non-invasive pituitary adenomas.
23267136 Our results indicate that PTTG immunoexpression is higher in aggressive brain tumors including medulloblastomas, GBM IV, and astrocytoma III, whereas in more benign tumors, PTTG immunoexpression is lower.
23164239 TgPTTG/p53+/- animals developed sarcomas faster than p53+/- alone.
23128677 The expression of hPTTG1 was correlated with differentiation levels, clinical classification and lymph node metastasis, but did not correlate with gender, age or pathological types.
23051594 gonadotroph tumor cell proliferation is determined by the interplay between cell-specific FOXL2 with PTTG and Clusterin
22994714 No association between PTTG1 expression and clinical T stage.
22819078 Results show that a single mutation in pttg1 is sufficient to trigger the oncogenic properties of Securin. The finding of this point mutation in patients might be used as an effective strategy for early detection of cancer.
22805307 Expression of the PTTG1 oncogene is associated with aggressive clear cell renal cell carcinoma.
22789011 Our findings provide novel molecular insights into hPTTG1-induced senescence and identify a novel mechanism by which hPTTG1 promotes metastasis by regulating the senescence-associated microenvironment.
22783570 The combination of Galectin-3 and PTTG is complementary as a diagnostic biomarker for patients with papillary carcinoma.
22522436 [review] The pituitary tumor transforming gene (PTTG) is a multifunctional proto-oncogene that is over-expressed in various tumors including thyroid carcinomas, where it is a prognostic indicator of tumor recurrence.
22511756 PTTG1-mediated malignant tumor properties were due, at least in part, to activation of AKT, known to be a key regulator of both EMT and stemness in cancer cells.
22475756 PTTG1 could alter the proliferation status by modulating the expression levels of the other cell cycle regulatory proteins, and excess PTTG1 primarily affects early differentiation of keratinocytes.
22419713 Determination of the expression of PTTG1 in an attempt to establish correlations and/or associations with clinical characteristics of patients with nonfunctioning pituitary adenomas.
22260438 in human breast cancer, that high-level securin expression predicts abnormal DNA content, with up to 9.8-fold odds for aneuploid DNA content. Securin also shows strong independent prognostic value for disease-specific survival.
22209758 EAP1 gene expression is under dual transcriptional regulation imposed by a transactivator (TTF1) and two repressors (YY1 and CUX1) previously postulated to be upstream components of a puberty-controlling gene network.
22081074 an important role of PTTG in regulation of integrins alpha(V) and beta(3) and adhesion-complex proteins leading to induction of EMT
22002306 Study shows that hPTTG1 is a transcription factor that triggers the GEF-H1/RhoA pathway to accelerate breast cancer invasion and metastasis. In human invasive breast carcinoma, hPTTG1 is overexpressed and is correlated to GEF-H1 expression.
21937724 study demonstrate that in different cell types, a portion of cytoplasmic PTTG1 is associated with the cis face of the Golgi apparatus and this localization depends on PTTG1 phosphorylation status
21858218 Findings suggest PTTG1 as a tumor cell marker to predict anti-neoplastic treatment outcomes.
21839581 Authors observed up regulation of TGF-beta, Twist, Snail, Slug, vimentin and down regulation of E-cadherin on infection of ovarian tumor cells with Ad-PTTG cDNA.
21757741 a strong correlation between securin accumulation and GSK3beta inactivation was observed in breast cancer tissues, indicating that GSK3beta inactivation may account for securin accumulation in breast cancers.
21439054 Though no significant association was found between PTTG1 haplotypes and the risk of pituitary adenoma, this is the first report on the association of individual PTTG1 SNPs or PTTG1 haplotypes with the risk of pituitary adenoma based on a solid study.
21336306 Cdc20 requires APC3 and APC8 to bind and activate the APC/C when the spindle assembly checkpoint is satisfied, but only APC8 when active, and APC10 is crucial for the destruction of cyclin B1 and securin, but not cyclin A
21272169 Results identify a new functional role of securin and separase in the modulation of membrane traffic and protein secretion that implicates regulation of V-ATPase assembly and function.
21181309 high expression of PTTG1 and low expression of PTEN may be involved in pathogenesis and development of endometrial carcinoma
21176344 overexpression of pttg may be related to the pathogenesis and progression of AML
21129230 PTTG1's role in endocrine cancers is discussed. [review]
21126432 SMC3 and separase are upregulated and securin is downregulated in malignant transformation of BEAS-2B cells induced by coal tar pitch smoke extracts.
21099350 the PTTG1 gene is up-regulated in the cancerous tissue from patients with hepatocellular carcinoma (HCC) and involved in the progression of HCC
21069851 This study provides the first evidence that PTTG1 is involved in the early stages of oral tumorigenesis.
21068098 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20978326 PTTG1 levels correlate with tumour aggressiveness in medullary thyroid carcinoma
20962850 Observational study of gene-disease association. (HuGE Navigator)
20953187 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20650808 Increased PTTG protein expression may be involved in the carcinogenesis and progression of renal clear cell carcinoma.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20621061 these results suggest that the JAK2V617F/STAT5 signaling pathway promotes cell proliferation through the transcriptional activation of PTTG1.
20506293 the opposing effects of baicalein on securin and gamma-H2AX levels may be involved in the regulation of cell viability and genomic stability by this compound.
20452981 PTTG1 overexpression in normal human fibroblasts caused chromosome instability, which subsequently induced p53-dependent senescence through activation of DNA-damage response pathway.
20406982 Estrogen treatment in postmenopausal women may upregulate PBF expression, leading to PBF secretion and increased cell invasion.
20198633 the interaction between PTTG1 and the Skp1-Cul1-F-box ubiquitin ligase complex (SCF) was partially disrupted, possibly through a mechanism involving protein-protein interactions of HBx with PTTG1 and/or SCF
20116377 In human HCCs, KLF6 mRNA was significantly decreased, associated with increased PTTG1. In HepG2, KLF6 transcriptionally repressed PTTG1 by direct promoter interaction.
20106827 PTTG was differentially expressed in pituitary adenoma subtypes suggests a cell-specific function for PTTG.
19958546 PTTG may induce apoptosis by down-regulation of oncogenes such as v-Jun and v-maf and up-regulation of the histone family of genes.
19840458 The expression of pituitary tumor transforming gene mRNA was significantly correlated with the expression of c-myc gene in multiple myeloma.
19837943 Results elucidate a mechanism for abundant tumor hPTTG1 expression, whereby Rb inactivation releases E2F1 to induce hPTTG1. This signaling pathway may underlie the requirement of PTTG1 for pituitary tumorigenesis.
19690544 Securin promotes the identification of favourable outcome in invasive breast cancer.
19539243 Oveexpression of p300 upregulated hPTTG at the levels of promoter activity, mRNA and protein expression.
19477929 PTTG1 and DLK1 are involved in cell differentiation and transformation.
19407503 Pituitary tumour-transforming gene (PTTG) and pituitary senescence.
19351864 Findings elucidate the molecular mechanisms of PTTG overexpression in promoting tumor metastasis, whereby up-regulated PTTG modulates expression and secretion of metastasis-related factors to facilitate cell motility.
19302955 The Ep-CAM and PTTG-1 expression in craniopharyngioma could be used as prediction markers of relapsing tumor
19117984 BubR1 competes with Cdc20 for binding to securin. Interaction of BubR1 and securin is increased by the depletion of Cdc20. Regulation of BubR1 may generate an anaphase-inhibitory signal through the Cdc20-independent interaction of BubR1 with securin.
19053469 securin is not entirely disordered, but segregates into a largely disordered N-terminal half and a C-terminal half with transient segmental order
19008095 Observational study of gene-disease association. (HuGE Navigator)
19000457 hPTTG1 is overexpressed in colorectal cancer and closely related to disease progression.
18984771 TACC1 and a three-gene expression signature (TACC1, NOV, and PTTG1) were identified as independent prognostic markers.
18753362 PTTG expression and its correlation with clinicopathologic parameters in patients with neoplasms, particularly of endocrine organs.
18663361 PTTG1 regulates aurora kinase activity.
18620995 Atypias and mitosis figures were associated to PTTG-1 expression
18594525 results of a small sample of invasive ductal breast carcinoma patients suggest that low securin expression identifies a distinct subgroup of more favourable outcome among patients with high Ki-67 immunoexpression or high mitotic activity index
18550719 Oct-1 transactivates hPTTG1, and both proteins are concordantly overexpressed in endocrine tumors.
18522889 The oncogene PTTG1 was overexpressed in pancreatic tumor tissues and verified by RT-PCR detection. The methylation status of DNA in promoter areas was involved in the gene expression with the help of other factors in pancreatic cancer.
18451147 PTTG1 overexpression promotes cell motility and lymph node metastasis in esophageal squamous cell carcinoma patients, leading to poorer survival.
18426563 Neither methylation alterations nor LOH are involved in PTTG1 over-expression. These data, together with those previously reported, point towards a post-transcriptional level of misregulation associated to PTTG1 over-expression.
18384692 PTTG-1 is aberrantly expressed in multiple myeloma plasma cells, is highly immunogenic and is a suitable target for immunotherapy of multiple myeloma.
18339849 PTTG1 gene expression is mediated by Sp1 and is indirectly down-regulated by T(3). Overexpression of PTTG1 or SP1 in HCCs is TR-dependent and crucial in the development of HCC.
18245958 Overexpression of gamma-catenin caused an increase in PTTG and c-Myc protein levels, which are likely to accelerate chromosomal instability and uncontrolled proliferation, respectively, in the affected cells.
18217976 The decrease in expression of cytoplasmic and nuclear PTTG seen for endometrial cancer cells was statistically significant (P < 0.05)
18047793 UV irradiation decreased PTTG1 mRNA and protein expression. These effects were found to be mediated by JNK pathway.
17962814 data suggest that securin has a key role in the maintenance of genomic stability after DNA damage, thereby providing a previously unknown mechanism for regulating tumour progression
17854787 existence of securin promotes apoptosis via a p53-indpendent pathway after radiation in human colorectal cancer cells
17652795 PTTG is localized in cytoplasm of pituitary tumor cells.
17507465 Data show that overexpression of human pituitary tumor transforming gene cooperated with the HTLV-I Tax oncoprotein in cellular transformation.
17383977 HCT116 cells devoid of PTTG1/securin (sec(-/-) HCT116) show a stabilized yet transcriptionally latent form of p53 protein in the absence of DNA damage.
17353909 Results show that PTTG1 exhibits properties of a global transcription factor, and specifically modulates the G1/S-phase transition by interacting with Sp1.
17297475 overexpression of PTTG and PBF in differentiated thyroid cancer has profound implications for activity of the NIS gene, and hence significantly impacts upon the efficacy of radioiodine treatment.
17210994 Observational study of gene-disease association. (HuGE Navigator)
17071631 securin may be a critical gene in the development of genetic instability in colorectal cancer.
16926250 Novel PTTG-mediated proliferative pathway that may be critical to thyroid cancer growth and progression.
16820881 PTTG has a role in lung tumor growth, and its suppression may inhibit tumor growth
16809406 PTTG participates in the pathogenesis of various tumors, including pituitary tumors, by inducing aneuploidy and upregulating FGF-2, a potent mitogenic and angiogenic factor.
16799481 PTTG1 is overexpressed in nodular melanoma, and contributes to tumor progression by causing aneuploidy or by modulating p53-function
16705313 High expression of beta-catenin and securin (hPTTG1) in colorectal adenomas and carcinomas; securin is a target of beta-catenin transcriptional activation.
16705156 Treatment of cells with okadaic acid, a potent inhibitor of PP2A, results in various hyperphosphorylated forms of hSecurin which are extremely unstable, due to the action of the Skp1/Cul1/F-box protein complex ubiquitin ligase.
16685397 Data suggest that increased expression of PTTG1 contributes to the tumorigenicity of glioma cells.
16394085 PTTG may promote angiogenesis by regulating the expression of multiple genes with both pro- and antiangiogenic properties and may thus be a key gene in triggering the angiogenic switch in thyroid tumorigenesis.
16292982 data demonstrate that securin is dispensable for chromosomal stability in human cells
16205121 Securin degradation is not sufficient for centromere separation or anaphase onset in human cells; other targets of the proteasome must be degraded to allow anaphase onset.
15922332 insulin and IGF-1 regulate the expression of PTTG in MCF-7 cells primarily through the activation of PI3K/AKT cascade
15897900 PTTG may be an important gene in the mutator phenotype development in thyroid cancer
15880121 density map at a resolution of 25 A of negatively stained separase-securin complex
15846392 Abundant cytoplasmic and nuclear securin expression was demonstrated in all 90 breast tumors.
15769981 PTTG-1 is up-regulated in human uterine leiomyomas and that the positive feedback loop between PTTG-1 and basic fibroblast growth factor may be pivotal in the growth of leiomyoma cells.
15649325 Demonstration of the importance of PTTG1 in human tumorigenesis.
15591026 PXXP structure and phosphorylation are likely to exert independent and critical influences upon PTTG's diverse actions in vitro
15514942 As a target gene of beta-catenin/TCF pathway, PTTG may play an important role in tumorigenesis of human esophageal squamous cell carcinoma.
15281346 Clinical studies reveal that PTTG-binding factor, fibroblast growth factor 2, and vascular endothelial growth factor are elevated in pituitary tumors, and mostly correlate with PTTG levels, also confirming the PTTG role in angiogenesis. Review.
15178645 higher PTTG expression in astrocytoma than normal astrocytes and PTTG is involved in glioma cell growth.
15024062 Results suggest that human securin has a novel role in cell cycle arrest after exposure to UV light or ionizing radiation.
14966902 PTTG1 expression is enhanced in metastatic lymph nodes in comparison to that in primary carcinomas and may contribute to lymph node metastases in gastric carcinoma
14709851 Overexpression of hPTTG inhibits the cell growth due to different mechanisms, which are p21WAF1/CIP1 -dependent and -independent.
14671639 Results do not support a major role of hSecurin in the development of aneuploidy in myeloid leukaemias. However, high expression of hSecurin may be of pathogenetic relevance in a subset of patients.
12960092 Failure of PTTG degradation or enhanced PTTG accumulation, as a consequence of overexpression, inhibits mitosis progression and chromosome segregation but does not directly affect cytokinesis, resulting in aneuploidy.
12958169 A potential role for PTTG in modulating cell proliferation and FGF-2 expression in the fetal brain.
12727994 pituitary tumor transforming gene and fibroblast growth factor-2 expression are potential prognostic markers (and perhaps therapeutic targets) for differentiated thyroid cancer
12590639 The relationship between pituitary tumour transforming gene (PTTG) expression and in vitro growth hormone and vascular endothelial growth factor (VEGF) secretion from human pituitary adenomas.
12554778 PTTG1-mediated signaling alters the hormonal phenotype in pituitary
12444553 the involvement of hpttg in lymphomagenesis
12403781 Data suggest that securin is a p53 target gene and may play a role in p53-mediated cellular response to DNA damage.
12355087 the oncogenic effect of increased expression of securin may result from modulation of p53 functions
12324572 Tumor tissue expressed a significantly higher level of PTTG1 mRNA than the corresponding normal tissue. PTTG1 mRNA expression was significantly higher in tumors with higher pathological stage or more extensive lymph node metastasis
12213878 findings implicate altered VEGF and KDR signaling in pituitary tumorigenesis; PTTG stimulation of FGF-2 and VEGF expression in the presence of up-regulated growth factor receptors may account for angiogenic growth and progression of human pituitary tumors
12194817 Data suggest that separase is required for sister chromatid separation during mitosis in human cells, and that securin inhibits separase by blocking the access of substrates to the active site of separase.

AA Sequence

MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFDAPPALPKATRKALGTVNRA      1 - 70
TEKSVKTKGPLKQKQPSFSAKKMTEKTVKAKSSVPASDDAYPEIEKFFPFNPLDFESFDLPEEHQIAHLP     71 - 140
LSGVPLMILDEERELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLDVELPPVCCDIDI            141 - 202
//

Text Mined References (178)

PMID Year Title
26900962 2016 Alteration of Pituitary Tumor Transforming Gene-1 Regulates Trophoblast Invasion via the Integrin/Rho-Family Signaling Pathway.
26824458 2016 Pttg1 Promotes Growth of Breast Cancer through P27 Nuclear Exclusion.
26710612 2015 [PTTG1 enhances Hepatitis B Virus replication through P53].
26516926 2015 PTTG regulates the metabolic switch of ovarian cancer cells via the c-myc pathway.
26445238 2015 PTTG1 expression is associated with hyperproliferative disease and poor prognosis in multiple myeloma.
26320179 2015 The PTTG1-targeting miRNAs miR-329, miR-300, miR-381, and miR-655 inhibit pituitary tumor cell tumorigenesis and are involved in a p53/PTTG1 regulation feedback loop.
26264222 2015 FoxM1 transactivates PTTG1 and promotes colorectal cancer cell migration and invasion.
25908389 2015 Pituitary tumor transforming gene: a novel therapeutic target for glioma treatment.
25877755 2015 MiRNA-494 inhibits metastasis of cervical cancer through Pttg1.
25874498 2015 A Aconitum coreanum polysaccharide fraction induces apoptosis of hepatocellular carcinoma (HCC) cells via pituitary tumor transforming gene 1 (PTTG1)-mediated suppression of the P13K/Akt and activation of p38 MAPK signaling pathway and displays antitumor activity in vivo.
25871022 2015 Expression of the pituitary tumor transforming gene (PTTG1) in pheochromocytoma as a potential marker for distinguishing benign versus malignant tumors.
25739119 2015 Novel antigens in non-small cell lung cancer: SP17, AKAP4, and PTTG1 are potential immunotherapeutic targets.
25549700 2014 Involvement of pituitary tumor transforming gene 1 in psoriasis, seborrheic keratosis, and skin tumors.
25227666 2015 Pttg1 inhibits TGF? signaling in breast cancer cells to promote their growth.
24908230 2014 Characterization of pituitary tumor transforming gene in meningiomas.
24879625 2014 Pituitary tumor-transforming gene 1 (PTTG1) is overexpressed in oral squamous cell carcinoma (OSCC) and promotes migration, invasion and epithelial-mesenchymal transition (EMT) in SCC15 cells.
24853182 2014 Cdc20 and securin overexpression predict short-term breast cancer survival.
24816985 2014 Changes in PTTG1 by human TERT gene expression modulate the self-renewal of placenta-derived mesenchymal stem cells.
24754453 2015 Pituitary-tumour-transforming-gene 1 expression in testicular cancer.
24627133 2014 PTTG1 inhibits SMAD3 in prostate cancer cells to promote their proliferation.
24594688 2014 Correlations of pituitary tumor transforming gene expression with human pituitary adenomas: a meta-analysis.
24377512 2013 Effects of PTTG down-regulation on proliferation and metastasis of the SCL-1 cutaneous squamous cell carcinoma cell line.
24314023 2013 Mir-655 up-regulation suppresses cell invasion by targeting pituitary tumor-transforming gene-1 in esophageal squamous cell carcinoma.
24238056 2013 PTTG1 overexpression in adrenocortical cancer is associated with poor survival and represents a potential therapeutic target.
24176776 2014 Overexpression of pituitary tumor transforming gene (PTTG) is associated with tumor progression and poor prognosis in patients with esophageal squamous cell carcinoma.
24051510 2013 Molecular and gene network analysis of thyroid transcription factor 1 (TTF1) and enhanced at puberty (EAP1) genes in patients with GnRH-dependent pubertal disorders.
23977008 2013 Down-regulation of the oncogene PTTG1 via the KLF6 tumor suppressor during induction of myeloid differentiation.
23867215 2013 Regulation of pituitary tumor transforming gene (PTTG) expression and phosphorylation in thyroid cells.
23850618 2013 Downregulation of Securin by the variant RNF213 R4810K (rs112735431, G>A) reduces angiogenic activity of induced pluripotent stem cell-derived vascular endothelial cells from moyamoya patients.
23798554 2013 Critical differences between isoforms of securin reveal mechanisms of separase regulation.
23755904 2013 Low cdc27 and high securin expression predict short survival for breast cancer patients.
23677169 2013 Pituitary tumor transforming gene 1 induces tumor necrosis factor-? production from keratinocytes: implication for involvement in the pathophysiology of psoriasis.
23671127 2013 PTTG1 promotes migration and invasion of human non-small cell lung cancer cells and is modulated by miR-186.
23527717 Clinical significance of pituitary tumor transforming gene 1 and transgelin-2 in pancreatic cancer.
23523951 2013 Evidence of securin-mediated resistance to gefitinib-induced apoptosis in human cancer cells.
23489647 2013 Pituitary tumor-transforming gene 1 as a proliferation marker lacking prognostic value in cutaneous squamous cell carcinoma.
23416975 2014 PTTG acts as a STAT3 target gene for colorectal cancer cell growth and motility.
23404407 2013 Expression of pituitary tumor transforming gene (PTTG) in human pituitary macroadenomas.
23267136 2013 Immunohistochemical expression of PTTG in brain tumors.
23164239 2012 Tumorigenic potential of pituitary tumor transforming gene (PTTG) in vivo investigated using a transgenic mouse model, and effects of cross breeding with p53 (+/-) transgenic mice.
23128677 2013 Expression and the clinical significance of hPTTG1 in gastric cancer.
23051594 2012 Clusterin and FOXL2 act concordantly to regulate pituitary gonadotroph adenoma growth.
22994714 2012 Expression of pituitary tumor transforming gene 1 is an independent factor of poor prognosis in localized or locally advanced prostate cancer cases receiving hormone therapy.
22819078 2013 A single mutation in Securin induces chromosomal instability and enhances cell invasion.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22805307 2012 Expression of the PTTG1 oncogene is associated with aggressive clear cell renal cell carcinoma.
22791750 2012 Genome-wide association study identifies novel loci association with fasting insulin and insulin resistance in African Americans.
22789011 2012 Human pituitary tumor-transforming gene 1 overexpression reinforces oncogene-induced senescence through CXCR2/p21 signaling in breast cancer cells.
22783570 2012 The use of a combination of Ki-67, Galectin-3, and PTTG can distinguish the benign and malignant thyroid tumor.
22522436 2012 The pituitary tumor transforming gene in thyroid cancer.
22511756 2012 PTTG1 oncogene promotes tumor malignancy via epithelial to mesenchymal transition and expansion of cancer stem cell population.
22475756 2012 Pituitary tumor-transforming gene 1 enhances proliferation and suppresses early differentiation of keratinocytes.
22419713 2012 Expression of Ki-67, PTTG1, FGFR4, and SSTR 2, 3, and 5 in nonfunctioning pituitary adenomas: a high throughput TMA, immunohistochemical study.
22260438 2012 Securin predicts aneuploidy and survival in breast cancer.
22209758 2012 Transcription of the human EAP1 gene is regulated by upstream components of a puberty-controlling Tumor Suppressor Gene network.
22081074 2012 PTTG induces EMT through integrin ?V?3-focal adhesion kinase signaling in lung cancer cells.
22002306 2012 Overexpressed hPTTG1 promotes breast cancer cell invasion and metastasis by regulating GEF-H1/RhoA signalling.
21937724 2011 PTTG1/securin modulates microtubule nucleation and cell migration.
21858218 2011 PTTG1 attenuates drug-induced cellular senescence.
21839581 2011 Pituitary tumor transforming gene induces epithelial to mesenchymal transition by regulation of Twist, Snail, Slug, and E-cadherin.
21757741 2011 Glycogen synthase kinase-3beta (GSK3beta) negatively regulates PTTG1/human securin protein stability, and GSK3beta inactivation correlates with securin accumulation in breast tumors.
21439054 2011 Pituitary tumor transforming gene-1 haplotypes and risk of pituitary adenoma: a case-control study.
21408207 2011 Differential genetic associations for systemic lupus erythematosus based on anti-dsDNA autoantibody production.
21336306 2011 How APC/C-Cdc20 changes its substrate specificity in mitosis.
21272169 2011 Securin and separase modulate membrane traffic by affecting endosomal acidification.
21181309 2012 Expression of PTTG1 and PTEN in endometrial carcinoma: correlation with tumorigenesis and progression.
21176344 2010 [Expression of pituitary tumor transforming gene in patients with AML].
21129230 2010 Pituitary tumor-transforming gene and its binding factor in endocrine cancer.
21126432 2010 [Change of structural maintenance of chromosome (SMC)1, SMC3, Separase and Securin expression in BEAS-2B malignant transformation cell induced by coal tar pitch smoke extracts].
21099350 2011 Role of the pituitary tumor transforming gene 1 in the progression of hepatocellular carcinoma.
21069851 2011 Association of pituitary tumor transforming gene expression with early oral tumorigenesis and malignant progression of precancerous lesions.
21068098 2011 Study of the common genetic background for rheumatoid arthritis and systemic lupus erythematosus.
20978326 2010 Role of pituitary tumour transforming gene 1 in medullary thyroid carcinoma.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
20953187 2010 Association analyses identify six new psoriasis susceptibility loci in the Chinese population.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20650808 2010 [Expression of pituitary tumor transforming gene in human renal clear cell carcinoma and its significance].
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20621061 2010 JAK2V617F/STAT5 signaling pathway promotes cell proliferation through activation of Pituitary Tumor Transforming Gene 1 expression.
20506293 2010 Opposite expression of securin and ?-H2AX regulates baicalein-induced cancer cell death.
20452981 2010 Overexpression of the pituitary tumor transforming gene induces p53-dependent senescence through activating DNA damage response pathway in normal human fibroblasts.
20406982 2010 Pituitary tumor transforming gene binding factor: a new gene in breast cancer.
20198633 2010 Expression of pituitary tumor-transforming gene 1 (PTTG1)/securin in hepatitis B virus (HBV)-associated liver diseases: evidence for an HBV X protein-mediated inhibition of PTTG1 ubiquitination and degradation.
20116377 2010 Tumor suppressor activity of KLF6 mediated by downregulation of the PTTG1 oncogene.
20106827 2010 Immunohistochemical expression of pituitary tumor transforming gene (PTTG) in pituitary adenomas: a correlative study of tumor subtypes.
19958546 2009 Effect of PTTG on endogenous gene expression in HEK 293 cells.
19840458 2009 [Expression of pituitary tumor transforming gene and C-myc gene in patients with multiple myeloma].
19837943 2009 E2F1 induces pituitary tumor transforming gene (PTTG1) expression in human pituitary tumors.
19690544 2009 Securin promotes the identification of favourable outcome in invasive breast cancer.
19539243 2009 Histone acetyltransferase p300 regulates the expression of human pituitary tumor transforming gene (hPTTG).
19477929 2009 Induction of Dlk1 by PTTG1 inhibits adipocyte differentiation and correlates with malignant transformation.
19407503 2009 Pituitary tumour-transforming gene (PTTG) and pituitary senescence.
19351864 2009 PTTG overexpression promotes lymph node metastasis in human esophageal squamous cell carcinoma.
19302955 2009 Expression of epithelial cell adhesion molecule and pituitary tumor transforming gene in adamantinomatous craniopharyngioma and its correlation with recurrence of the tumor.
19117984 2009 Functional interaction between BubR1 and securin in an anaphase-promoting complex/cyclosomeCdc20-independent manner.
19053469 2008 Structural and dynamic characterization of intrinsically disordered human securin by NMR spectroscopy.
19008095 2009 Single nucleotide polymorphisms in chromosomal instability genes and risk and clinical outcome of breast cancer: a Swedish prospective case-control study.
19000457 2008 [Expression of human pituitary tumor transforming gene 1 in colorectal cancer detected with real-time fluorescent quantitative PCR and its clinical significance].
18984771 2009 Identification of TACC1, NOV, and PTTG1 as new candidate genes associated with endocrine therapy resistance in breast cancer.
18753362 2008 Pituitary tumor-transforming gene in endocrine and other neoplasms: a review and update.
18663361 2008 Pituitary tumor transforming gene 1 regulates Aurora kinase A activity.
18620995 2008 Phosphatase and tensin homologue and pituitary tumor-transforming gene in pituitary adenomas. Clinical-pathologic and immunohistochemical analysis.
18594525 2008 Proliferation marker securin identifies favourable outcome in invasive ductal breast cancer.
18550719 2008 Oct-1 induces pituitary tumor transforming gene expression in endocrine tumors.
18522889 2008 Epigenetic changes of pituitary tumor-derived transforming gene 1 in pancreatic cancer.
18485873 2008 Mechanism of ubiquitin-chain formation by the human anaphase-promoting complex.
18451147 2008 Pituitary tumor-transforming 1 increases cell motility and promotes lymph node metastasis in esophageal squamous cell carcinoma.
18426563 2008 Methylation alterations are not a major cause of PTTG1 misregulation.
18384692 2008 The pituitary tumor transforming gene 1 (PTTG-1): an immunological target for multiple myeloma.
18339849 2008 Thyroid hormone receptors suppress pituitary tumor transforming gene 1 activity in hepatoma.
18245958 2007 Aberrant activation of gamma-catenin promotes genomic instability and oncogenic effects during tumor progression.
18217976 Expression of pituitary tumor-transforming gene in endometrial cancer as a prognostic marker.
18047793 2007 The important anti-apoptotic role and its regulation mechanism of PTTG1 in UV-induced apoptosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17962814 2008 Proliferative potential after DNA damage and non-homologous end joining are affected by loss of securin.
17854787 2007 Expression of securin promotes colorectal cancer cell death via a p53-independent pathway after radiation.
17652795 2007 PTTG is a secretory protein in human pituitary adenomas and in mouse pituitary tumor cell lines.
17507465 2007 Evidence for cooperative transforming activity of the human pituitary tumor transforming gene and human T-cell leukemia virus type 1 Tax.
17383977 2007 p53 stabilization can be uncoupled from its role in transcriptional activation by loss of PTTG1/securin.
17353909 2007 Pituitary tumor transforming gene interacts with Sp1 to modulate G1/S cell phase transition.
17297475 2007 PTTG and PBF repress the human sodium iodide symporter.
17210994 2007 Breast cancer risk associated with genotypic polymorphism of the mitotic checkpoint genes: a multigenic study on cancer susceptibility.
17071631 2007 Securin induces genetic instability in colorectal cancer by inhibiting double-stranded DNA repair activity.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16926250 2006 Pituitary tumor transforming gene (PTTG) stimulates thyroid cell proliferation via a vascular endothelial growth factor/kinase insert domain receptor/inhibitor of DNA binding-3 autocrine pathway.
16820881 2006 Suppression of lung cancer with siRNA targeting PTTG.
16809406 2006 The emerging role of pituitary tumor transforming gene in tumorigenesis.
16799481 2006 Expression and possible role of hPTTG1/securin in cutaneous malignant melanoma.
16705313 2006 Securin (hPTTG1) expression is regulated by beta-catenin/TCF in human colorectal carcinoma.
16705156 2006 Protein phosphatase 2A stabilizes human securin, whose phosphorylated forms are degraded via the SCF ubiquitin ligase.
16685397 2006 Increased expression of pituitary tumor-transforming gene (PTTG)-1 is correlated with poor prognosis in glioma patients.
16394085 2006 Pituitary tumor-transforming gene regulates multiple downstream angiogenic genes in thyroid cancer.
16292982 2005 Securin is not required for chromosomal stability in human cells.
16205121 2005 Proteasome activity is required for centromere separation independently of securin degradation in human cells.
15922332 2005 Insulin and IGF-1 regulate the expression of the pituitary tumor transforming gene (PTTG) in breast tumor cells.
15897900 2005 Pituitary tumour transforming gene (PTTG) induces genetic instability in thyroid cells.
15880121 2005 Domain structure of separase and its binding to securin as determined by EM.
15846392 2005 Securin is overexpressed in breast cancer.
15769981 2005 Expression and functional analysis of pituitary tumor transforming gene-1 [corrected] in uterine leiomyomas.
15649325 2005 Ectopic expression of PTTG1/securin promotes tumorigenesis in human embryonic kidney cells.
15591026 2004 PTTG's C-terminal PXXP motifs modulate critical cellular processes in vitro.
15514942 2005 Overexpression of human pituitary tumor transforming gene (hPTTG), is regulated by beta-catenin /TCF pathway in human esophageal squamous cell carcinoma.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15281346 2004 Pituitary tumor transforming gene: an update.
15178645 2004 Expression of pituitary tumor transforming gene (PTTG) and its binding protein in human astrocytes and astrocytoma cells: function and regulation of PTTG in U87 astrocytoma cells.
15024062 2004 Securin is a target of the UV response pathway in mammalian cells.
14966902 2004 Expression of pituitary tumor transforming gene in human gastric carcinoma.
14709851 2003 Human pituitary tumor transforming gene (hPTTG) inhibits human lung cancer A549 cell growth through activation of p21(WAF1/CIP1 ).
14671639 2004 High expression of the sister-chromatid separation regulator and proto-oncogene hSecurin occurs in a subset of myeloid leukaemias but is not implicated in the pathogenesis of aneuploidy.
12960092 2003 Overexpressed pituitary tumor-transforming gene causes aneuploidy in live human cells.
12958169 2003 A potential role for PTTG/securin in the developing human fetal brain.
12727994 2003 Pituitary tumor transforming gene and fibroblast growth factor-2 expression: potential prognostic indicators in differentiated thyroid cancer.
12590639 2003 The relationship between pituitary tumour transforming gene (PTTG) expression and in vitro hormone and vascular endothelial growth factor (VEGF) secretion from human pituitary adenomas.
12554778 2003 Human pituitary tumor-transforming gene (PTTG1) motif suppresses prolactin expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444553 2002 Expression of hpttg proto-oncogene in lymphoid neoplasias.
12403781 2003 DNA damage-induced inhibition of securin expression is mediated by p53.
12355087 2002 Human securin interacts with p53 and modulates p53-mediated transcriptional activity and apoptosis.
12324572 2002 Expression of PTTG (pituitary tumor transforming gene) in esophageal cancer.
12213878 2002 Vascular endothelial growth factor, its receptor KDR/Flk-1, and pituitary tumor transforming gene in pituitary tumors.
12194817 2002 Regulation of human separase by securin binding and autocleavage.
12070128 2002 Human securin proteolysis is controlled by the spindle checkpoint and reveals when the APC/C switches from activation by Cdc20 to Cdh1.
11553328 2001 The anaphase inhibitor Pds1 binds to the APC/C-associated protein Cdc20 in a destruction box-dependent manner.
11371342 2001 Securin is required for chromosomal stability in human cells.
11238996 2001 Human securin, hPTTG, is associated with Ku heterodimer, the regulatory subunit of the DNA-dependent protein kinase.
11179223 2001 Securin degradation is mediated by fzy and fzr, and is required for complete chromatid separation but not for cytokinesis.
11158059 2001 Human pituitary tumor-transforming gene induces angiogenesis.
10781616 2000 A novel binding factor facilitates nuclear translocation and transcriptional activation function of the pituitary tumor-transforming gene product.
10656688 2000 Cell cycle regulated expression and phosphorylation of hpttg proto-oncogene product.
10580151 1999 Molecular cloning, genomic organization, and identification of the promoter for the human pituitary tumor transforming gene (PTTG).
10411507 1999 Identification of a vertebrate sister-chromatid separation inhibitor involved in transformation and tumorigenesis.
10393434 1999 Molecular cloning and characterization of the tumor transforming gene (TUTR1): a novel gene in human tumorigenesis.
10365261 1999 Cloning and expression of human cDNA encoding human homologue of pituitary tumor transforming gene.
10022450 1999 Pituitary tumor transforming gene (PTTG) expression in pituitary adenomas.
9925941 1998 Assignment of the human tumor transforming gene TUTR1 to chromosome band 5q35.1 by fluorescence in situ hybridization.
9915854 1999 Pituitary tumor-transforming gene protein associates with ribosomal protein S10 and a novel human homologue of DnaJ in testicular cells.
9892021 1999 Structure, expression, and function of human pituitary tumor-transforming gene (PTTG).
9811450 1998 hpttg, a human homologue of rat pttg, is overexpressed in hematopoietic neoplasms. Evidence for a transcriptional activation function of hPTTG.