Property Summary

NCBI Gene PubMed Count 28
PubMed Score 39.79
PubTator Score 17.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
invasive ductal carcinoma 1.500 3.3e-03
lung cancer 2.000 5.0e-04
ovarian cancer 1.200 9.1e-04
psoriasis 1.100 4.6e-03

Gene RIF (19)

AA Sequence

MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILV      1 - 70
VRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTV     71 - 140
SLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY                                   141 - 179
//

Text Mined References (34)

PMID Year Title