Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.00
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
posterior fossa group B ependymoma 416 3.4e-07

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.300 3.4e-07

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (2)

AA Sequence

MRPGGFLGAGQRLSRAMSRCVLEPRPPGKRWMVAGLGNPGLPGTRHSVGMAVLGQLARRLGVAESWTRDR      1 - 70
HCAADLALAPLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVHDELDKPLGRLALKLGGSARG     71 - 140
HNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCFSPAEQELLPLLLDRATDLILDHIRERSQGP    141 - 210
SLGP                                                                      211 - 214
//

Text Mined References (10)

PMID Year Title