Property Summary

NCBI Gene PubMed Count 63
PubMed Score 143.98
PubTator Score 86.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma 2.200 6.5e-03
oligodendroglioma 2.500 2.1e-03
esophageal adenocarcinoma -1.200 2.4e-02
glioblastoma 1.500 3.2e-05
sonic hedgehog group medulloblastoma -3.600 6.6e-06
medulloblastoma, large-cell -3.100 1.7e-03
non-small cell lung cancer 3.415 9.9e-12
colon cancer -2.000 5.9e-07
interstitial cystitis 1.800 1.3e-03
cystic fibrosis 2.300 7.2e-04
pediatric high grade glioma 1.600 5.2e-06
pilocytic astrocytoma 2.000 2.1e-08
nasopharyngeal carcinoma -2.000 2.7e-02
breast carcinoma -1.400 7.6e-16
Breast cancer -4.100 1.5e-20
ovarian cancer -4.300 2.2e-12
pituitary cancer -1.700 3.1e-03

Gene RIF (43)

PMID Text
26851024 Confirm contribution of PTPRZ1, and especially PTPRQ, in CRC carcinogenesis and demonstrated that PTPRQ expression is correlated with KRAS mutation.
25935522 Data indicate that enhanced MET oncoprotein RNA expression by fusion with receptor-type tyrosine-protein phosphatase zeta (PTPRZ1).
25238264 Distinct domains of PTPRZ-B are differentially required for migration and proliferation of glioma cells, respectively.
25135958 Data indicate that the fusion arose from translocation events involving introns 3 or 8 of protein tyrosine phosphatase, receptor-type, Z polypeptide 1 (PTPRZ1) and intron 1 of hepatocyte growth factor receptor MET.
24242166 High expression of PTP receptors R and Z1 was observed in all examined cases of colorectal carcinoma, adenoma and normal colon tissue in this study.
23777859 Ligand independent activation of anaplastic lymphoma kinase (ALK) results when the cytokine pleiotrophin (PTN) interacts with its receptor, the receptor protein tyrosine phosphatase beta-zeta (RPTPbeta-zeta). Review)
23744080 Data suggest that CSF-1R-independent actions of IL-34 via receptor-type protein-tyrosine phosphatase zeta (PTP-zeta) might be considered in evaluating IL-34 roles in development and disease.
23588815 Protein tyrosine phosphatase zeta enhances proliferation by increasing beta-catenin nuclear expression in VHL-inactive human renal cell carcinoma cells.
23570448 PTPRZ1 is affected in a contiguous gene deletion syndrome
23226095 Receptor-type Protein tyrosine phosphatase beta regulates met phosphorylation and function in head and neck squamous cell carcinoma.
23170925 PTPRZ1 was highly expressed in human neuroendocrine tumor tissues and PTPRZ1 is an oncogenic tyrosine phosphatase in small-cell lung carcinoma.
23100427 The results of this study suggested that pleiotrophin inhibition of PTPRZ1 contributes to the homeostatic self-renewal of OPCs and that this process is mediated by the tonic activation of beta-catenin/TCF-dependent transcription.
23060448 Loss of RPTPZ promotes prostate cancer metastasi.
22832403 Enhanced RPTPbeta/zeta signaling can contribute to schizophrenia phenotypes and support both construct and face validity for PTPRZ1-transgenic mice as a model for multiple schizophrenia phenotypes.
22682003 Studies indicate that RPTPzeta is an RPTP for which a link between ligand-dependent dimerization and inhibition of the intracellular tyrosine phosphatase activity has been clearly established.
21969550 report the cocrystal structure of the carbonic anhydrase-like domain of PTPRZ bound to tandem Ig repeats of CNTN1 and binding assays to show that PTPRZ binds specifically to CNTN1 expressed at the surface of oligodendrocyte precursor cells
21890632 molecular basis for the substrate recognition of Ptprz.
21454675 RPTP-beta is a key regulator of Met function.
20738847 results demonstrate that P(122-131) inhibits biological activities that are related to the induction of a transformed phenotype in PCa cells, by interacing with RPTPbeta-zeta and interfering with other pleiotrophin receptors
20224786 preferential activation of PTPRZ1 by HIF-2 results at least in part from cooperative binding of HIF-2 and ELK1 to nearby sites on the PTPRZ1 promoter region
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20133774 findings implicate PTPRG, PTPRZ and CNTNs as a group of receptors and ligands involved in the manifold recognition events that underlie the construction of neural networks
19604403 phosphacan was present in the evolving astroglial scar after human traumatic spinal cord injury, and, therefore, might play an important role in the blockade of successful CNS regeneration.
19141530 these data suggest that alpha(v)beta(3) is a key molecule that determines the stimulatory or inhibitory effect of pleiotrophin on cell migration.
19058221 PTN through its receptor RPTPbeta/zeta is a mediator of the stimulatory effects of eNOS/NO on human endothelial and prostate cancer cell migration
18838383 GnT-Vb-mediated glycosylation of RPTPbeta promotes galectin-1 binding and RPTPbeta levels of retention on the cell surface.
18713734 the cleavage sites in the extracellular juxtamembrane region of Ptprz by tumor necrosis factor-alpha converting enzyme and matrix metalloproteinase 9.
18186075 PTPRZ1 is unlikely to be related to the development of schizophrenia in the Japanese population
18186075 Observational study of gene-disease association. (HuGE Navigator)
18003890 results from the immunohistochemical analyses of rPTPbeta/zeta expression should prompt further evaluation of this protein as a novel oligodendroglioma marker.
17823238 Pleiotrophin receptor (PTPRZ1) is expressed in embryonic stem cells and mediates important signals for survival, proliferation, and maintenance of pluripotency state.
17727841 the effect of the shorter basic peptide P(122-131) on DU145 cells, which express HARP and its receptor RPTPB, suggested interference, under anchorage-independent conditions, of P(122-131) with a HARP autocrine loop in an RPTPB -dependent fashion.
17706593 the PTN/RPTPbeta/zeta signaling pathway may be constitutively activated and potentially function to constitutively activate ALK in human breast cancer
17681947 phosphorylation of ALK in PTN-stimulated cells is mediated through the PTN/RPTPbeta/zeta signaling pathway
17579610 Observational study of gene-disease association. (HuGE Navigator)
17368428 Midkine, pleiotrophin (PTN), and their receptors syndecan-3 and receptor protein tyrosine phosphatase beta/zeta, were highly expressed in the striatum during developmen
17098867 Data suggest that increased tyrosine phosphorylation of receptor protein tyrosine phosphatase beta/zeta substrates in pleiotrophin-stimulated cells is sufficient to coordinately stimulate the functions needed for an epithelial-mesenchymal transition.
17030583 In AZ-521 cells, which mainly express RPTPbeta, VacA, after binding to RPTPbeta in non-lipid raft microdomains on the cell surface, is localized with RPTPbeta in lipid rafts in a temperature- and VacA concentration-dependent process.
16338072 PTPRA and PTPRZ may have roles in gastric cancer progression including lymphovascular invasion and liver/peritoneal dissemination
15998549 Observational study of gene-disease association. (HuGE Navigator)
15797857 RPTPbeta/zeta is a receptor of HARP in human endothelial cells
14555979 RPTPzeta has a novel role in regulating glioblastoma cell motility
12355066 PTPRZ1 has a role in oligodendrocyte survival and in recovery from demyelinating disease

AA Sequence

MRILKRFLACIQLLCVCRLDWANGYYRQQRKLVEEIGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDL      1 - 70
TQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGS     71 - 140
EHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQA    141 - 210
ALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDY    211 - 280
LQNNFREQQYKFSRQVFSSYTGKEEIHEAVCSSEPENVQADPENYTSLLVTWERPRVVYDTMIEKFAVLY    281 - 350
QQLDGEDQTKHEFLTDGYQDLGAILNNLLPNMSYVLQIVAICTNGLYGKYSDQLIVDMPTDNPELDLFPE    351 - 420
LIGTEEIIKEEEEGKDIEEGAIVNPGRDSATNQIRKKEPQISTTTHYNRIGTKYNEAKTNRSPTRGSEFS    421 - 490
GKGDVPNTSLNSTSQPVTKLATEKDISLTSQTVTELPPHTVEGTSASLNDGSKTVLRSPHMNLSGTAESL    491 - 560
NTVSITEYEEESLLTSFKLDTGAEDSSGSSPATSAIPFISENISQGYIFSSENPETITYDVLIPESARNA    561 - 630
SEDSTSSGSEESLKDPSMEGNVWFPSSTDITAQPDVGSGRESFLQTNYTEIRVDESEKTTKSFSAGPVMS    631 - 700
QGPSVTDLEMPHYSTFAYFPTEVTPHAFTPSSRQQDLVSTVNVVYSQTTQPVYNGETPLQPSYSSEVFPL    701 - 770
VTPLLLDNQILNTTPAASSSDSALHATPVFPSVDVSFESILSSYDGAPLLPFSSASFSSELFRHLHTVSQ    771 - 840
ILPQVTSATESDKVPLHASLPVAGGDLLLEPSLAQYSDVLSTTHAASETLEFGSESGVLYKTLMFSQVEP    841 - 910
PSSDAMMHARSSGPEPSYALSDNEGSQHIFTVSYSSAIPVHDSVGVTYQGSLFSGPSHIPIPKSSLITPT    911 - 980
ASLLQPTHALSGDGEWSGASSDSEFLLPDTDGLTALNISSPVSVAEFTYTTSVFGDDNKALSKSEIIYGN    981 - 1050
ETELQIPSFNEMVYPSESTVMPNMYDNVNKLNASLQETSVSISSTKGMFPGSLAHTTTKVFDHEISQVPE   1051 - 1120
NNFSVQPTHTVSQASGDTSLKPVLSANSEPASSDPASSEMLSPSTQLLFYETSASFSTEVLLQPSFQASD   1121 - 1190
VDTLLKTVLPAVPSDPILVETPKVDKISSTMLHLIVSNSASSENMLHSTSVPVFDVSPTSHMHSASLQGL   1191 - 1260
TISYASEKYEPVLLKSESSHQVVPSLYSNDELFQTANLEINQAHPPKGRHVFATPVLSIDEPLNTLINKL   1261 - 1330
IHSDEILTSTKSSVTGKVFAGIPTVASDTFVSTDHSVPIGNGHVAITAVSPHRDGSVTSTKLLFPSKATS   1331 - 1400
ELSHSAKSDAGLVGGGEDGDTDDDGDDDDDDRGSDGLSIHKCMSCSSYRESQEKVMNDSDTHENSLMDQN   1401 - 1470
NPISYSLSENSEEDNRVTSVSSDSQTGMDRSPGKSPSANGLSQKHNDGKEENDIQTGSALLPLSPESKAW   1471 - 1540
AVLTSDEESGSGQGTSDSLNENETSTDFSFADTNEKDADGILAAGDSEITPGFPQSPTSSVTSENSEVFH   1541 - 1610
VSEAEASNSSHESRIGLAEGLESEKKAVIPLVIVSALTFICLVVLVGILIYWRKCFQTAHFYLEDSTSPR   1611 - 1680
VISTPPTPIFPISDDVGAIPIKHFPKHVADLHASSGFTEEFETLKEFYQEVQSCTVDLGITADSSNHPDN   1681 - 1750
KHKNRYINIVAYDHSRVKLAQLAEKDGKLTDYINANYVDGYNRPKAYIAAQGPLKSTAEDFWRMIWEHNV   1751 - 1820
EVIVMITNLVEKGRRKCDQYWPADGSEEYGNFLVTQKSVQVLAYYTVRNFTLRNTKIKKGSQKGRPSGRV   1821 - 1890
VTQYHYTQWPDMGVPEYSLPVLTFVRKAAYAKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVN   1891 - 1960
IFGFLKHIRSQRNYLVQTEEQYVFIHDTLVEAILSKETEVLDSHIHAYVNALLIPGPAGKTKLEKQFQLL   1961 - 2030
SQSNIQQSDYSAALKQCNREKNRTSSIIPVERSRVGISSLSGEGTDYINASYIMGYYQSNEFIITQHPLL   2031 - 2100
HTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKDEPINCESFKVTLMAEEHKCLSNEEKLIIQDF   2101 - 2170
ILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISVIKEEAANRDGPMIVHDEHGGVTAGTFCALTTLM   2171 - 2240
HQLEKENSVDVYQVAKMINLMRPGVFADIEQYQFLYKVILSLVSTRQEENPSTSLDSNGAALPDGNIAES   2241 - 2310
LESLV                                                                    2311 - 2315
//

Text Mined References (66)

PMID Year Title
26851024 2016 High PTPRQ Expression and Its Relationship to Expression of PTPRZ1 and the Presence of KRAS Mutations in Colorectal Cancer Tissues.
25935522 2015 Enhanced expression and phosphorylation of the MET oncoprotein by glioma-specific PTPRZ1-MET fusions.
25238264 2014 Intracellular and extracellular domains of protein tyrosine phosphatase PTPRZ-B differentially regulate glioma cell growth and motility.
25135958 2014 RNA-seq of 272 gliomas revealed a novel, recurrent PTPRZ1-MET fusion transcript in secondary glioblastomas.
24242166 2014 Immunohistochemical and Western blot analysis of two protein tyrosine phosphatase receptors, R and Z1, in colorectal carcinoma, colon adenoma and normal colon tissues.
23777859 2013 Anaplastic lymphoma kinase: "Ligand Independent Activation" mediated by the PTN/RPTP?/? signaling pathway.
23744080 2013 Receptor-type protein-tyrosine phosphatase ? is a functional receptor for interleukin-34.
23588815 2013 Protein tyrosine phosphatase ? enhances proliferation by increasing ?-catenin nuclear expression in VHL-inactive human renal cell carcinoma cells.
23570448 2013 Genetic basis of hyperlysinemia.
23226095 2012 Receptor-type Protein tyrosine phosphatase ? regulates met phosphorylation and function in head and neck squamous cell carcinoma.
23170925 2012 PTPRZ1 regulates calmodulin phosphorylation and tumor progression in small-cell lung carcinoma.
23100427 2012 Pleiotrophin suppression of receptor protein tyrosine phosphatase-?/? maintains the self-renewal competence of fetal human oligodendrocyte progenitor cells.
23060448 2012 Loss of receptor protein tyrosine phosphatase ?/? (RPTP?/?) promotes prostate cancer metastasis.
22832403 2011 Increased expression of receptor phosphotyrosine phosphatase-?/? is associated with molecular, cellular, behavioral and cognitive schizophrenia phenotypes.
22682003 2013 Receptor-type tyrosine phosphatase ligands: looking for the needle in the haystack.
21969550 2011 A complex between contactin-1 and the protein tyrosine phosphatase PTPRZ controls the development of oligodendrocyte precursor cells.
21890632 2011 Consensus substrate sequence for protein-tyrosine phosphatase receptor type Z.
21454675 2011 Receptor-type protein tyrosine phosphatase beta (RPTP-beta) directly dephosphorylates and regulates hepatocyte growth factor receptor (HGFR/Met) function.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20738847 2010 A Pleiotrophin C-terminus peptide induces anti-cancer effects through RPTP?/?.
20224786 2010 Characterization of the activation of protein tyrosine phosphatase, receptor-type, Z polypeptide 1 (PTPRZ1) by hypoxia inducible factor-2 alpha.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20133774 2010 The protein tyrosine phosphatases PTPRZ and PTPRG bind to distinct members of the contactin family of neural recognition molecules.
19604403 2009 NG2 and phosphacan are present in the astroglial scar after human traumatic spinal cord injury.
19167335 2009 Large-scale structural analysis of the classical human protein tyrosine phosphatome.
19141530 2009 Integrin alpha(v)beta(3) is a pleiotrophin receptor required for pleiotrophin-induced endothelial cell migration through receptor protein tyrosine phosphatase beta/zeta.
19058221 2009 Nitric oxide stimulates migration of human endothelial and prostate cancer cells through up-regulation of pleiotrophin expression and its receptor protein tyrosine phosphatase beta/zeta.
18838383 2008 Receptor tyrosine phosphatase beta (RPTPbeta) activity and signaling are attenuated by glycosylation and subsequent cell surface galectin-1 binding.
18713734 2008 Metalloproteinase- and gamma-secretase-mediated cleavage of protein-tyrosine phosphatase receptor type Z.
18186075 2008 No association between the protein tyrosine phosphatase, receptor-type, Z Polypeptide 1 (PTPRZ1) gene and schizophrenia in the Japanese population.
18003890 2008 Gene expression analyses of grade II gliomas and identification of rPTPbeta/zeta as a candidate oligodendroglioma marker.
17823238 2007 Pleiotrophin enhances clonal growth and long-term expansion of human embryonic stem cells.
17727841 2007 A basic peptide derived from the HARP C-terminus inhibits anchorage-independent growth of DU145 prostate cancer cells.
17706593 2007 The receptor protein tyrosine phosphatase (RPTP)beta/zeta is expressed in different subtypes of human breast cancer.
17681947 2007 Anaplastic lymphoma kinase is activated through the pleiotrophin/receptor protein-tyrosine phosphatase beta/zeta signaling pathway: an alternative mechanism of receptor tyrosine kinase activation.
17579610 2008 Molecular dissection of NRG1-ERBB4 signaling implicates PTPRZ1 as a potential schizophrenia susceptibility gene.
17368428 2007 Role of heparin binding growth factors in nigrostriatal dopamine system development and Parkinson's disease.
17098867 2006 Pleiotrophin disrupts calcium-dependent homophilic cell-cell adhesion and initiates an epithelial-mesenchymal transition.
17030583 2006 Clustering of Helicobacter pylori VacA in lipid rafts, mediated by its receptor, receptor-like protein tyrosine phosphatase beta, is required for intoxication in AZ-521 Cells.
16814777 2006 Protein tyrosine phosphatase receptor type Z is inactivated by ligand-induced oligomerization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16338072 2006 Protein tyrosine-phosphatase expression profiling in gastric cancer tissues.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15998549 2005 No association of FOXP2 and PTPRZ1 on 7q31 with autism from the Japanese population.
15908427 2005 Differential induction of glioblastoma migration and growth by two forms of pleiotrophin.
15833863 2005 Differential gene up-regulation by hypoxia-inducible factor-1alpha and hypoxia-inducible factor-2alpha in HEK293T cells.
15797857 2005 Characterization of heparin affin regulatory peptide signaling in human endothelial cells.
15523497 2005 Mutation screening and association analysis of six candidate genes for autism on chromosome 7q.
14555979 2003 A role for receptor tyrosine phosphatase zeta in glioma cell migration.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12355066 2002 A critical role for the protein tyrosine phosphatase receptor type Z in functional recovery from demyelinating lesions.
11520897 2001 Soluble forms of NCAM and F3 neuronal cell adhesion molecules promote Schwann cell migration: identification of protein tyrosine phosphatases zeta/beta as the putative F3 receptors on Schwann cells.
11381105 2001 Identification of GIT1/Cat-1 as a substrate molecule of protein tyrosine phosphatase zeta /beta by the yeast substrate-trapping system.
10706604 2000 Pleiotrophin signals increased tyrosine phosphorylation of beta beta-catenin through inactivation of the intrinsic catalytic activity of the receptor-type protein tyrosine phosphatase beta/zeta.
10521598 1999 Protein tyrosine phosphatase zeta/RPTPbeta interacts with PSD-95/SAP90 family.
10212223 1999 A receptor-like protein-tyrosine phosphatase PTPzeta/RPTPbeta binds a heparin-binding growth factor midkine. Involvement of arginine 78 of midkine in the high affinity binding to PTPzeta.
9847074 1998 Toward a complete human genome sequence.
9653645 1998 Molecular cloning and expression analysis of five novel genes in chromosome 1p36.
9441757 1997 Subregional localization of 21 chromosome 7-specific expressed sequence tags (ESTs) by FISH using newly identified YACs and P1s.
8387522 1993 The cloning of a receptor-type protein tyrosine phosphatase expressed in the central nervous system.
7736789 1995 Assignment of the human protein tyrosine phosphatase, receptor-type, zeta (PTPRZ) gene to chromosome band 7q31.3.
2170109 1990 Structural diversity and evolution of human receptor-like protein tyrosine phosphatases.
2169617 1990 Cloning of three human tyrosine phosphatases reveals a multigene family of receptor-linked protein-tyrosine-phosphatases expressed in brain.
1323835 1992 A human transmembrane protein-tyrosine-phosphatase, PTP zeta, is expressed in brain and has an N-terminal receptor domain homologous to carbonic anhydrases.