Property Summary

NCBI Gene PubMed Count 26
PubMed Score 242.28
PubTator Score 280.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 5.0e-46
interstitial cystitis 2299 8.8e-03
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis -1.200 8.8e-03
psoriasis -1.300 5.0e-46

Gene RIF (8)

PMID Text
25337216 PTPRU is required for gastric cancer cell proliferation and migration.
24876153 High PTPRU expression is associated with glioma growth and motility.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19528353 Gene expression of GLEPP-1 is decreased in podocytes from women with preeclampsia.
18854154 Knockdown of protein tyrosine phosphatase, receptor type U (PTPRU) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
16574648 PCP-2 may play an important role in the maintenance of epithelial integrity, and a loss of its regulatory function may be an alternative mechanism for activating beta-catenin signaling.
16564554 Reduced expression of both synaptopodin and GLEPP1 is associated with poor response to steroid therapy in primary focal segmental glomerulosclerosis.
12501215 Expressed in a cell density-dependent fashion, PCP-2 interacts directly with its substrate beta-catenin, independent of the tyrosine phosphorylation state of beta-catenin.

AA Sequence

MARAQALVLALTFQLCAPETETPAAGCTFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGTRAPADLPHGS      1 - 70
YLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDGHSPGTLGVYVRVNGGPLGSAVWNMTGSHG     71 - 140
RQWHQAELAVSTFWPNEYQVLFEALISPDRRGYMGLDDILLLSYPCAKAPHFSRLGDVEVNAGQNASFQC    141 - 210
MAAGRAAEAERFLLQRQSGALVPAAGVRHISHRRFLATFPLAAVSRAEQDLYRCVSQAPRGAGVSNFAEL    211 - 280
IVKEPPTPIAPPQLLRAGPTYLIIQLNTNSIIGDGPIVRKEIEYRMARGPWAEVHAVSLQTYKLWHLDPD    281 - 350
TEYEISVLLTRPGDGGTGRPGPPLISRTKCAEPMRAPKGLAFAEIQARQLTLQWEPLGYNVTRCHTYTVS    351 - 420
LCYHYTLGSSHNQTIRECVKTEQGVSRYTIKNLLPYRNVHVRLVLTNPEGRKEGKEVTFQTDEDVPSGIA    421 - 490
AESLTFTPLEDMIFLKWEEPQEPNGLITQYEISYQSIESSDPAVNVPGPRRTISKLRNETYHVFSNLHPG    491 - 560
TTYLFSVRARTGKGFGQAALTEITTNISAPSFDYADMPSPLGESENTITVLLRPAQGRGAPISVYQVIVE    561 - 630
EERARRLRREPGGQDCFPVPLTFEAALARGLVHYFGAELAASSLPEAMPFTVGDNQTYRGFWNPPLEPRK    631 - 700
AYLIYFQAASHLKGETRLNCIRIARKAACKESKRPLEVSQRSEEMGLILGICAGGLAVLILLLGAIIVII    701 - 770
RKGRDHYAYSYYPKPVNMTKATVNYRQEKTHMMSAVDRSFTDQSTLQEDERLGLSFMDTHGYSTRGDQRS    771 - 840
GGVTEASSLLGGSPRRPCGRKGSPYHTGQLHPAVRVADLLQHINQMKTAEGYGFKQEYESFFEGWDATKK    841 - 910
KDKVKGSRQEPMPAYDRHRVKLHPMLGDPNADYINANYIDGYHRSNHFIATQGPKPEMVYDFWRMVWQEH    911 - 980
CSSIVMITKLVEVGRVKCSRYWPEDSDTYGDIKIMLVKTETLAEYVVRTFALERRGYSARHEVRQFHFTA    981 - 1050
WPEHGVPYHATGLLAFIRRVKASTPPDAGPIVIHCSAGTGRTGCYIVLDVMLDMAECEGVVDIYNCVKTL   1051 - 1120
CSRRVNMIQTEEQYIFIHDAILEACLCGETTIPVSEFKATYKEMIRIDPQSNSSQLREEFQTLNSVTPPL   1121 - 1190
DVEECSIALLPRNRDKNRSMDVLPPDRCLPFLISTDGDSNNYINAALTDSYTRSAAFIVTLHPLQSTTPD   1191 - 1260
FWRLVYDYGCTSIVMLNQLNQSNSAWPCLQYWPEPGRQQYGLMEVEFMSGTADEDLVARVFRVQNISRLQ   1261 - 1330
EGHLLVRHFQFLRWSAYRDTPDSKKAFLHLLAEVDKWQAESGDGRTIVHCLNGGGRSGTFCACATVLEMI   1331 - 1400
RCHNLVDVFFAAKTLRNYKPNMVETMDQYHFCYDVALEYLEGLESR                           1401 - 1446
//

Text Mined References (31)

PMID Year Title
25337216 2014 Knockdown of protein tyrosine phosphatase receptor U inhibits growth and motility of gastric cancer cells.
24876153 2014 Protein tyrosine phosphatase receptor U (PTPRU) is required for glioma growth and motility.
23535911 2013 Genome-wide scan revealed that polymorphisms in the PNPLA3, SAMM50, and PARVB genes are associated with development and progression of nonalcoholic fatty liver disease in Japan.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19528353 2009 Decreased nephrin and GLEPP-1, but increased VEGF, Flt-1, and nitrotyrosine, expressions in kidney tissue sections from women with preeclampsia.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
17622474 2007 Involvement of beta3A subunit of adaptor protein-3 in intracellular trafficking of receptor-like protein tyrosine phosphatase PCP-2.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16574648 2006 Protein-tyrosine phosphatase PCP-2 inhibits beta-catenin signaling and increases E-cadherin-dependent cell adhesion.
16564554 2006 Expression of synaptopodin and GLEPP1 as markers of steroid responsiveness in primary focal segmental glomerulosclerosis.
16298104 2006 G-protein alpha subunit interaction and guanine nucleotide dissociation inhibitor activity of the dual GoLoco motif protein PCP-2 (Purkinje cell protein-2).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12501215 2002 Physical and functional interaction between receptor-like protein tyrosine phosphatase PCP-2 and beta-catenin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10397721 1999 The receptor protein tyrosine phosphatase, PTP-RO, is upregulated during megakaryocyte differentiation and Is associated with the c-Kit receptor.
10395944 1999 Transcriptional regulation of a receptor protein tyrosine phosphatase gene hPTP-J by PKC-mediated signaling pathways in Jurkat and Molt-4 T lymphoma cells.
10196137 1999 Interaction of heterotrimeric G protein Galphao with Purkinje cell protein-2. Evidence for a novel nucleotide exchange factor.
9624153 1998 Liprins, a family of LAR transmembrane protein-tyrosine phosphatase-interacting proteins.
9434160 1997 Characterization and chromosomal localization of PTPRO, a novel receptor protein tyrosine phosphatase, expressed in hematopoietic stem cells.
9305862 1997 Sortilin is a major protein component of Glut4-containing vesicles.
9070223 1997 Molecular cloning and characterization of a novel human receptor protein tyrosine phosphatase gene, hPTP-J: down-regulation of gene expression by PMA and calcium ionophore in Jurkat T lymphoma cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8870675 1996 Molecular cloning and characterization of PTP pi, a novel receptor-like protein-tyrosine phosphatase.
8700514 1996 Characterization of PCP-2, a novel receptor protein tyrosine phosphatase of the MAM domain family.