Property Summary

NCBI Gene PubMed Count 35
PubMed Score 44.69
PubTator Score 19.14

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
25592066 Results show that PTPRR is an early and direct target of the androgen receptor which negatively regulates the RAS/ERK1/2 pathway suggesting that its loss in prostate cancer cells is one factor that might contribute to activation of the RAS/ERK1/2 pathway.
24407576 The methylation index of PTPRR recovered from scrapings of uterine cervix adenocarcinomas is significantly higher than in normal controls.
24242166 High expression of PTP receptors R and Z1 was observed in all examined cases of colorectal carcinoma, adenoma and normal colon tissue in this study.
23422819 3 genes identified by association study and supported by ocular expression and/or replication, UHRF1BP1L, PTPRR, and PPFIA2, are novel candidates for myopic development within the MYP3 locus that should be further studied.
22330137 Methylation of the PTPRR promoter has an important role in the metastasis and may be a biomarker of invasive cervical cancer
22100128 the protein tyrosine phosphatase receptor type R gene may play a role in conferring risk of major depressive disorder in females
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20015382 expression of the PTPRR-1 isoform was inactivated in colorectal cancer cells as a result of de novo CpG island methylation and enrichment of transcription-repressive histone-tail marks, mainly H3K27me3
16441242 determined high-resolution structures of all of the human family members of Mitogen-Activated Protein Kinase-specific protein tyrosine phosphatases

AA Sequence

MRRAVCFPALCLLLNLHAAGCFSGNNDHFLAINQKKSGKPVFIYKHSQDIEKSLDIAPQKIYRHSYHSSS      1 - 70
EAQVSKRHQIVNSAFPRPAYDPSLNLLAMDGQDLEVENLPIPAANVIVVTLQMDVNKLNITLLRIFRQGV     71 - 140
AAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDALPSEEVLRSLNINVLHQSLSQFGITEVSPEK    141 - 210
NVLQGQHEADKIWSKEGFYAVVIFLSIFVIIVTCLMILYRLKERFQLSLRQDKEKNQEIHLSPITLQPAL    211 - 280
SEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSL    281 - 350
GNIEPFVSIPTPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNR    351 - 420
YKTILPNPLSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVDDFWQMVWQEDSPVIVM    421 - 490
ITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDS    491 - 560
AQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIATSIGCQQLKEEGVVDALSIVCQLRMDRGGM    561 - 630
VQTSEQYEFVHHALCLYESRLSAETVQ                                               631 - 657
//

Text Mined References (35)

PMID Year Title
25592066 2015 Androgen-regulation of the protein tyrosine phosphatase PTPRR activates ERK1/2 signalling in prostate cancer cells.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24407576 2014 High methylation rate of LMX1A, NKX6-1, PAX1, PTPRR, SOX1, and ZNF582 genes in cervical adenocarcinoma.
24242166 2014 Immunohistochemical and Western blot analysis of two protein tyrosine phosphatase receptors, R and Z1, in colorectal carcinoma, colon adenoma and normal colon tissues.
23422819 2013 Association mapping of the high-grade myopia MYP3 locus reveals novel candidates UHRF1BP1L, PTPRR, and PPFIA2.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22330137 2013 Epigenetic silencing of PTPRR activates MAPK signaling, promotes metastasis and serves as a biomarker of invasive cervical cancer.
22100128 2012 Gender-specific role of the protein tyrosine phosphatase receptor type R gene in major depressive disorder.
21724833 2011 Identification of PTPN23 as a novel regulator of cell invasion in mammary epithelial cells from a loss-of-function screen of the 'PTP-ome'.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20015382 2009 The protein tyrosine phosphatase receptor type R gene is an early and frequent target of silencing in human colorectal tumorigenesis.
19167335 2009 Large-scale structural analysis of the classical human protein tyrosine phosphatome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16541075 2006 The finished DNA sequence of human chromosome 12.
16441242 2006 Crystal structures and inhibitor identification for PTPN5, PTPRR and PTPN7: a family of human MAPK-specific protein tyrosine phosphatases.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16148006 2005 ERK2 shows a restrictive and locally selective mechanism of recognition by its tyrosine phosphatase inactivators not shared by its activator MEK1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12493773 2003 Global profiling of the cell surface proteome of cancer cells uncovers an abundance of proteins with chaperone function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12042304 2002 Phosphotyrosine-specific phosphatase PTP-SL regulates the ERK5 signaling pathway.
11493009 2001 Crystal structure of PTP-SL/PTPBR7 catalytic domain: implications for MAP kinase regulation.
11147789 2001 Type 2 diabetes locus on 12q15. Further mapping and mutation screening of two candidate genes.
10705342 2000 Protein tyrosine phosphatase (PC12, Br7,S1) family: expression characterization in the adult human and mouse.
10601328 1999 A novel regulatory mechanism of MAP kinases activation and nuclear translocation mediated by PKA and the PTP-SL tyrosine phosphatase.
10419510 1999 Interaction of mitogen-activated protein kinases with the kinase interaction motif of the tyrosine phosphatase PTP-SL provides substrate specificity and retains ERK2 in the cytoplasm.
10393441 1999 Assignment1 of the PTP-SL/PTPBR7 gene (Ptprr/PTPRR) to mouse chromosome region 8A2 by in situ hybridization.
10066421 1999 Inactivation of mitogen-activated protein kinases by a mammalian tyrosine-specific phosphatase, PTPBR7.
9857190 1998 PTP-SL and STEP protein tyrosine phosphatases regulate the activation of the extracellular signal-regulated kinases ERK1 and ERK2 by association through a kinase interaction motif.
7836467 1995 cDNA cloning and characterization of a novel receptor-type protein tyrosine phosphatase expressed predominantly in the brain.
7814416 1995 A neuronal protein tyrosine phosphatase induced by nerve growth factor.
7557444 1995 Cloning and expression of PCPTP1 encoding protein tyrosine phosphatase.