Property Summary

NCBI Gene PubMed Count 47
PubMed Score 68.80
PubTator Score 36.87

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma -2.438 3.9e-06
group 4 medulloblastoma -2.500 1.0e-06
medulloblastoma, large-cell -2.700 6.6e-04
non-small cell lung cancer -2.165 1.5e-23
lung cancer -1.600 7.3e-05
breast carcinoma -1.500 2.1e-04
fibroadenoma -1.600 2.2e-02
lung adenocarcinoma -1.800 3.8e-10
adult high grade glioma -1.800 9.4e-05
ductal carcinoma in situ -1.600 1.2e-03
invasive ductal carcinoma -2.200 1.3e-03
ulcerative colitis 1.800 6.1e-06
ovarian cancer 1.200 1.1e-02

Gene RIF (17)

PMID Text
24771611 Study determined that, in addition to the furin-processed form of PTPmicro, a pool of 200 kDa full-length PTPmicro exists at the plasma membrane that is cleaved directly by ADAM to generate a larger shed form of the PTPmicro extracellular segment.
23185569 Decreased expression of PTPRM in breast cancer is correlated with poor prognosis and inversely correlated with disease-free survival.
22505657 Loss of PTPmu by proteolysis causes glioblastoma.
21743492 Results suggest that miR-221 and -222 regulate glioma tumorigenesis at least in part through the control of PTPmu protein expression.
21649524 In A549 cells, diverse injurious stimuli dramatically reduced PTPmu protein expression.
20659327 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19690139 loss of cell surface PTPmu by proteolysis generates catalytically active PTPmu fragments that contribute to migration and survival of glioblastoma cells
19304959 Loss of protein tyrosine phosphatase receptor type mu is associated with glioma cell migration and progression.
18773424 BCCIP is phosphorylated by the Src tyrosine kinase and dephosphorylated by the PTPmu tyrosine phosphatase; neurite outgrowth assays suggest that BCCIP and PTPmu are in a common signal transduction pathway.
17761881 a 3.1 angstrom crystal structure of the RPTPmu ectodomain that forms a homophilic trans (antiparallel) dimer with an extended and rigid architecture, matching the dimensions of adherens junctions is described
16380380 PTPmu may regulate Rho-GTPase-dependent functions of IQGAP1
12895029 RPTPmu may play a role in the regulation of cardiovascular functions
12376545 interactions between RPTP-domain1s and RPTP-domain 2s are a common but specific mechanism that is likely to be regulated- domain2s and the wedge structures are crucial determinants of binding specificity, thus regulating cross-talk between RPTPs

AA Sequence

MRGLGTCLATLAGLLLTAAGETFSGGCLFDEPYSTCGYSQSEGDDFNWEQVNTLTKPTSDPWMPSGSFML      1 - 70
VNASGRPEGQRAHLLLPQLKENDTHCIDFHYFVSSKSNSPPGLLNVYVKVNNGPLGNPIWNISGDPTRTW     71 - 140
NRAELAISTFWPNFYQVIFEVITSGHQGYLAIDEVKVLGHPCTRTPHFLRIQNVEVNAGQFATFQCSAIG    141 - 210
RTVAGDRLWLQGIDVRDAPLKEIKVTSSRRFIASFNVVNTTKRDAGKYRCMIRTEGGVGISNYAELVVKE    211 - 280
PPVPIAPPQLASVGATYLWIQLNANSINGDGPIVAREVEYCTASGSWNDRQPVDSTSYKIGHLDPDTEYE    281 - 350
ISVLLTRPGEGGTGSPGPALRTRTKCADPMRGPRKLEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYC    351 - 420
YQVGGQEQVREEVSWDTENSHPQHTITNLSPYTNVSVKLILMNPEGRKESQELIVQTDEDLPGAVPTESI    421 - 490
QGSTFEEKIFLQWREPTQTYGVITLYEITYKAVSSFDPEIDLSNQSGRVSKLGNETHFLFFGLYPGTTYS    491 - 560
FTIRASTAKGFGPPATNQFTTKISAPSMPAYELETPLNQTDNTVTVMLKPAHSRGAPVSVYQIVVEEERP    561 - 630
RRTKKTTEILKCYPVPIHFQNASLLNSQYYFAAEFPADSLQAAQPFTIGDNKTYNGYWNTPLLPYKSYRI    631 - 700
YFQAASRANGETKIDCVQVATKGAATPKPVPEPEKQTDHTVKIAGVIAGILLFVIIFLGVVLVMKKRKLA    701 - 770
KKRKETMSSTRQEMTVMVNSMDKSYAEQGTNCDEAFSFMDTHNLNGRSVSSPSSFTMKTNTLSTSVPNSY    771 - 840
YPDETHTMASDTSSLVQSHTYKKREPADVPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYESFFEG    841 - 910
QSAPWDSAKKDENRMKNRYGNIIAYDHSRVRLQTIEGDTNSDYINGNYIDGYHRPNHYIATQGPMQETIY    911 - 980
DFWRMVWHENTASIIMVTNLVEVGRVKCCKYWPDDTEIYKDIKVTLIETELLAEYVIRTFAVEKRGVHEI    981 - 1050
REIRQFHFTGWPDHGVPYHATGLLGFVRQVKSKSPPSAGPLVVHCSAGAGRTGCFIVIDIMLDMAEREGV   1051 - 1120
VDIYNCVRELRSRRVNMVQTEEQYVFIHDAILEACLCGDTSVPASQVRSLYYDMNKLDPQTNSSQIKEEF   1121 - 1190
RTLNMVTPTLRVEDCSIALLPRNHEKNRCMDILPPDRCLPFLITIDGESSNYINAALMDSYKQPSAFIVT   1191 - 1260
QHPLPNTVKDFWRLVLDYHCTSVVMLNDVDPAQLCPQYWPENGVHRHGPIQVEFVSADLEEDIISRIFRI   1261 - 1330
YNAARPQDGYRMVQQFQFLGWPMYRDTPVSKRSFLKLIRQVDKWQEEYNGGEGRTVVHCLNGGGRSGTFC   1331 - 1400
AISIVCEMLRHQRTVDVFHAVKTLRNNKPNMVDLLDQYKFCYEVALEYLNSG                     1401 - 1452
//

Text Mined References (51)

PMID Year Title
24771611 2014 A protease storm cleaves a cell-cell adhesion molecule in cancer: multiple proteases converge to regulate PTPmu in glioma cells.
24583629 2014 Genome-wide analysis of methotrexate pharmacogenomics in rheumatoid arthritis shows multiple novel risk variants and leads for TYMS regulation.
23185569 2012 Protein tyrosine phosphatase µ (PTP µ or PTPRM), a negative regulator of proliferation and invasion of breast cancer cells, is associated with disease prognosis.
22505657 2012 Protein tyrosine phosphatase mu regulates glioblastoma cell growth and survival in vivo.
21743492 2012 miR-221/222 overexpession in human glioblastoma increases invasiveness by targeting the protein phosphate PTP?.
21649524 2011 Diverse injurious stimuli reduce protein tyrosine phosphatase-? expression and enhance epidermal growth factor receptor signaling in human airway epithelia.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
20659327 2010 Trait-stratified genome-wide association study identifies novel and diverse genetic associations with serologic and cytokine phenotypes in systemic lupus erythematosus.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690139 2009 Proteolytic cleavage of protein tyrosine phosphatase mu regulates glioblastoma cell migration.
19304959 2009 PTPmu suppresses glioma cell migration and dispersal.
19167335 2009 Large-scale structural analysis of the classical human protein tyrosine phosphatome.
18773424 2008 BCCIP associates with the receptor protein tyrosine phosphatase PTPmu.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18566238 2008 Synergistic effects of methylnaltrexone with 5-fluorouracil and bevacizumab on inhibition of vascular endothelial growth factor-induced angiogenesis.
17965016 2008 Involvement of nectin in inactivation of integrin alpha(v)beta(3) after the establishment of cell-cell adhesion.
17761881 2007 Structure of a tyrosine phosphatase adhesive interaction reveals a spacer-clamp mechanism.
17276081 2007 E-cadherin promotes retinal ganglion cell neurite outgrowth in a protein tyrosine phosphatase-mu-dependent manner.
16456543 2006 Molecular analysis of receptor protein tyrosine phosphatase mu-mediated cell adhesion.
16380380 2006 The receptor protein-tyrosine phosphatase PTPmu interacts with IQGAP1.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15978577 2005 Transmembrane homodimerization of receptor-like protein tyrosine phosphatases.
15706045 2005 Impaired flow-induced dilation in mesenteric resistance arteries from receptor protein tyrosine phosphatase-mu-deficient mice.
15588985 2005 Substrate-trapping techniques in the identification of cellular PTP targets.
15491993 2005 The conserved immunoglobulin domain controls the subcellular localization of the homophilic adhesion receptor protein-tyrosine phosphatase mu.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15080886 2004 PTPmu signaling via PKCdelta is instructive for retinal ganglion cell guidance.
14623235 2003 The receptor protein tyrosine phosphatase mu, PTPmu, regulates histogenesis of the chick retina.
12895029 2003 Receptor protein tyrosine phosphatase mu expression as a marker for endothelial cell heterogeneity; analysis of RPTPmu gene expression using LacZ knock-in mice.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376545 2002 Intra- and intermolecular interactions between intracellular domains of receptor protein-tyrosine phosphatases.
11278757 2001 The PTPmu protein-tyrosine phosphatase binds and recruits the scaffolding protein RACK1 to cell-cell contacts.
10809770 2000 Intramolecular interactions between the juxtamembrane domain and phosphatase domains of receptor protein-tyrosine phosphatase RPTPmu. Regulation of catalytic activity.
10777529 2000 Multiple interactions between receptor protein-tyrosine phosphatase (RPTP) alpha and membrane-distal protein-tyrosine phosphatase domains of various RPTPs.
10753936 2000 Receptor protein-tyrosine phosphatase RPTPmu binds to and dephosphorylates the catenin p120(ctn).
10094839 1999 Receptor-type protein-tyrosine phosphatase mu is expressed in specific vascular endothelial beds in vivo.
9624153 1998 Liprins, a family of LAR transmembrane protein-tyrosine phosphatase-interacting proteins.
9531566 1998 Dynamic interaction of PTPmu with multiple cadherins in vivo.
9346878 1997 The crystal structure of domain 1 of receptor protein-tyrosine phosphatase mu.
8620001 1996 Increased proteolytic processing of protein tyrosine phosphatase mu in confluent vascular endothelial cells: the role of PC5, a member of the subtilisin family.
8404049 1993 Fine mapping of the human receptor-like protein tyrosine phosphatase gene (PTPRM) to 18p11.2 by fluorescence in situ hybridization.
8394372 1993 Homophilic binding of PTP mu, a receptor-type protein tyrosine phosphatase, can mediate cell-cell aggregation.
8393854 1993 Cell-cell adhesion mediated by a receptor-like protein tyrosine phosphatase.
7961788 1994 Identification of the homophilic binding site of the receptor protein tyrosine phosphatase PTP mu.
7782276 1995 Homophilic interactions mediated by receptor tyrosine phosphatases mu and kappa. A critical role for the novel extracellular MAM domain.
7642713 1995 Receptor protein tyrosine phosphatase PTPmu associates with cadherins and catenins in vivo.
1655529 1991 Cloning, expression and chromosomal localization of a new putative receptor-like protein tyrosine phosphatase.