Property Summary

NCBI Gene PubMed Count 38
PubMed Score 27.79
PubTator Score 28.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
chronic lymphocytic leukemia -2.601 9.6e-04
Barrett's esophagus 1.200 2.6e-02
esophageal adenocarcinoma 1.700 1.9e-02
glioblastoma -1.500 9.9e-04
medulloblastoma, large-cell -2.100 3.6e-02
juvenile dermatomyositis 1.172 1.1e-09
acute quadriplegic myopathy 1.072 2.0e-06
tuberculosis and treatment for 3 months 1.300 1.5e-02
fibroadenoma 1.100 2.5e-02
pediatric high grade glioma -1.100 2.4e-03
group 4 medulloblastoma -1.900 4.9e-05
aldosterone-producing adenoma -1.184 1.8e-02
ovarian cancer -1.200 1.3e-03
pituitary cancer -2.600 2.3e-05
dermatomyositis 1.600 1.5e-03

Gene RIF (19)

PMID Text
25612622 PTPRK underexpression leads to STAT3 activation and contributes to nasal NK/T-cell lymphoma pathogenesis
25609089 Notch and TGF-beta act in concert to stimulate induction of PTPRK, which suppresses EGFR activation in human keratinocytes.
25378349 By regulating phosphorylation of SRC, RPTPkappa promotes the pathogenic action of rheumatoid arthritis fibroblast-like synoviocytes, mediating cross-activation of growth factor and inflammatory cytokine signalling by TGFbeta in RA FLS.
24882578 Findings strongly indicate that the tyrosine phosphorylation of CD133, which is dephosphorylated by PTPRK, regulates AKT signaling and has a critical role in colon cancer progression.
24002526 High expression of PTPRK is associated with prostate cancer.
23820479 PTPRK showed lower mRNA expression in duodenal mucose of celiac disease patients.
23696788 Tumor derived mutations of protein tyrosine phosphatase receptor type k affect its function and alter sensitivity to chemotherapeutics in glioma.
23552869 PTPRK is a negative regulator of adhesion, invasion, migration, and proliferation of breast cancer cells.
21094132 PTPkappa was scissored by the processed form of proprotein convertase 5, and galectin-3 binding protein which is over-produced in colon cancer cells and tissues.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19911372 Our results suggest that GnT-V could decrease human hepatoma SMMC-7721 cell adhesion and promote cell proliferation partially through RPTPkappa.
19864455 These data describe a novel mechanism of cross-talk between EGFR and TGF-beta pathways, in which RPTP-kappa functions to integrate growth-promoting and growth-inhibiting signaling pathways.
19800317 These data indicate that PPTRK positively regulates ERK1/2 phosphorylation, which impacts CD4(+) T cell development.
19236842 overexpression of GnT-V in a hepatoma cell line not only induced the addition of beta1,6 GlcNAc branch to N-glycan of RPTPkappa but also decreased the protein level of RPTPkappa
18276111 PTPRK influences transactivating activity of beta-catenin in non-tumoral and neoplastic cells by regulating the balance between signaling and adhesive beta-catenin, thus providing biochemical basis for the hypothesis of PTPRK as a tumor suppressor gene.
17720884 EBNA1 apparently disables TGF-beta signaling, which subsequently decreases transcription of the PTPRK tumor suppressor
16849327 EGF receptor is activated in human keratinocytes by oxidative inhibition of receptor-type protein-tyrosine phosphatase kappa by ultraviolet irradiation
16672235 the crystal structure of catalytically active, monomeric D1 domain of RPTPkappa at 1.9 A. RPTPkappa is monomeric in solution and crystal structure.
16263724 RPTP-kappa is a key regulator of EGFR tyrosine phosphorylation and function in human keratinocytes

AA Sequence

MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSAGGCTFDDGPGACDYHQDLYDDFEWVHVSAQEPHYLPP      1 - 70
EMPQGSYMIVDSSDHDPGEKARLQLPTMKENDTHCIDFSYLLYSQKGLNPGTLNILVRVNKGPLANPIWN     71 - 140
VTGFTGRDWLRAELAVSTFWPNEYQVIFEAEVSGGRSGYIAIDDIQVLSYPCDKSPHFLRLGDVEVNAGQ    141 - 210
NATFQCIATGRDAVHNKLWLQRRNGEDIPVAQTKNINHRRFAASFRLQEVTKTDQDLYRCVTQSERGSGV    211 - 280
SNFAQLIVREPPRPIAPPQLLGVGPTYLLIQLNANSIIGDGPIILKEVEYRMTSGSWTETHAVNAPTYKL    281 - 350
WHLDPDTEYEIRVLLTRPGEGGTGLPGPPLITRTKCAEPMRTPKTLKIAEIQARRIAVDWESLGYNITRC    351 - 420
HTFNVTICYHYFRGHNESKADCLDMDPKAPQHVVNHLPPYTNVSLKMILTNPEGRKESEETIIQTDEDVP    421 - 490
GPVPVKSLQGTSFENKIFLNWKEPLDPNGIITQYEISYSSIRSFDPAVPVAGPPQTVSNLWNSTHHVFMH    491 - 560
LHPGTTYQFFIRASTVKGFGPATAINVTTNISAPTLPDYEGVDASLNETATTITVLLRPAQAKGAPISAY    561 - 630
QIVVEELHPHRTKREAGAMECYQVPVTYQNAMSGGAPYYFAAELPPGNLPEPAPFTVGDNRTYQGFWNPP    631 - 700
LAPRKGYNIYFQAMSSVEKETKTQCVRIATKAATEEPEVIPDPAKQTDRVVKIAGISAGILVFILLLLVV    701 - 770
ILIVKKSKLAKKRKDAMGNTRQEMTHMVNAMDRSYADQSTLHAEDPLSITFMDQHNFSPRYENHSATAES    771 - 840
SRLLDVPRYLCEGTESPYQTGQLHPAIRVADLLQHINLMKTSDSYGFKEEYESFFEGQSASWDVAKKDQN    841 - 910
RAKNRYGNIIAYDHSRVILQPVEDDPSSDYINANYIDGYQRPSHYIATQGPVHETVYDFWRMIWQEQSAC    911 - 980
IVMVTNLVEVGRVKCYKYWPDDTEVYGDFKVTCVEMEPLAEYVVRTFTLERRGYNEIREVKQFHFTGWPD    981 - 1050
HGVPYHATGLLSFIRRVKLSNPPSAGPIVVHCSAGAGRTGCYIVIDIMLDMAEREGVVDIYNCVKALRSR   1051 - 1120
RINMVQTEEQYIFIHDAILEACLCGETAIPVCEFKAAYFDMIRIDSQTNSSHLKDEFQTLNSVTPRLQAE   1121 - 1190
DCSIACLPRNHDKNRFMDMLPPDRCLPFLITIDGESSNYINAALMDSYRQPAAFIVTQYPLPNTVKDFWR   1191 - 1260
LVYDYGCTSIVMLNEVDLSQGCPQYWPEEGMLRYGPIQVECMSCSMDCDVINRIFRICNLTRPQEGYLMV   1261 - 1330
QQFQYLGWASHREVPGSKRSFLKLILQVEKWQEECEEGEGRTIIHCLNGGGRSGMFCAIGIVVEMVKRQN   1331 - 1400
VVDVFHAVKTLRNSKPNMVEAPEQYRFCYDVALEYLESS                                  1401 - 1439
//

Text Mined References (44)

PMID Year Title
25612622 2015 Receptor-type tyrosine-protein phosphatase ? directly targets STAT3 activation for tumor suppression in nasal NK/T-cell lymphoma.
25609089 2015 Notch and TGF-? pathways cooperatively regulate receptor protein tyrosine phosphatase-? (PTPRK) gene expression in human primary keratinocytes.
25378349 2016 TGF? responsive tyrosine phosphatase promotes rheumatoid synovial fibroblast invasiveness.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24882578 2015 Receptor-type protein tyrosine phosphatase ? directly dephosphorylates CD133 and regulates downstream AKT activation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24002526 2013 Receptor-like protein tyrosine phosphatase ? negatively regulates the apoptosis of prostate cancer cells via the JNK pathway.
23820479 2014 THEMIS and PTPRK in celiac intestinal mucosa: coexpression in disease and after in vitro gliadin challenge.
23696788 2013 Tumor derived mutations of protein tyrosine phosphatase receptor type k affect its function and alter sensitivity to chemotherapeutics in glioma.
23552869 2013 Protein tyrosine phosphatase kappa (PTPRK) is a negative regulator of adhesion and invasion of breast cancer cells, and associates with poor prognosis of breast cancer.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21690299 2011 The lysyl oxidase propeptide interacts with the receptor-type protein tyrosine phosphatase kappa and inhibits ?-catenin transcriptional activity in lung cancer cells.
21094132 2011 Galectin-3 binding protein promotes cell motility in colon cancer by stimulating the shedding of protein tyrosine phosphatase kappa by proprotein convertase 5.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20068591 2010 A genome-wide association study for age-related hearing impairment in the Saami.
19911372 2010 The effect of receptor protein tyrosine phosphatase kappa on the change of cell adhesion and proliferation induced by N-acetylglucosaminyltransferase V.
19864455 2010 Receptor type protein tyrosine phosphatase-kappa mediates cross-talk between transforming growth factor-beta and epidermal growth factor receptor signaling pathways in human keratinocytes.
19836242 2009 An unbiased screen identifies DEP-1 tumor suppressor as a phosphatase controlling EGFR endocytosis.
19800317 2009 Protein-tyrosine phosphatase-kappa regulates CD4+ T cell development through ERK1/2-mediated signaling.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19236842 2009 EGF-mediated migration signaling activated by N-acetylglucosaminyltransferase-V via receptor protein tyrosine phosphatase kappa.
19167335 2009 Large-scale structural analysis of the classical human protein tyrosine phosphatome.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18276111 2008 PTPRK negatively regulates transcriptional activity of wild type and mutated oncogenic beta-catenin and affects membrane distribution of beta-catenin/E-cadherin complexes in cancer cells.
17720884 2008 Down-regulation of the TGF-beta target gene, PTPRK, by the Epstein-Barr virus encoded EBNA1 contributes to the growth and survival of Hodgkin lymphoma cells.
16849327 2006 Oxidative inhibition of receptor-type protein-tyrosine phosphatase kappa by ultraviolet irradiation activates epidermal growth factor receptor in human keratinocytes.
16672235 2006 The crystal structure of human receptor protein tyrosine phosphatase kappa phosphatase domain 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16263724 2005 Receptor-type protein-tyrosine phosphatase-kappa regulates epidermal growth factor receptor function.
15899872 2005 Transforming growth factor {beta} (TGF-{beta})-Smad target gene protein tyrosine phosphatase receptor type kappa is required for TGF-{beta} function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12794170 2003 Identification of a mutated receptor-like protein tyrosine phosphatase kappa as a novel, class II HLA-restricted melanoma antigen.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11710941 2001 Protein tyrosine phosphatase genes downregulated in melanoma.
9722959 1998 Cytogenetical assignment and physical mapping of the human R-PTP-kappa gene (PTPRK) to the putative tumor suppressor gene region 6q22.2-q22.3.
9047348 1997 Molecular cloning and chromosomal localization of a human gene homologous to the murine R-PTP-kappa, a receptor-type protein tyrosine phosphatase.
8941358 1996 Transforming growth factor-beta1 inhibits human keratinocyte proliferation by upregulation of a receptor-type tyrosine phosphatase R-PTP-kappa gene expression.
8663237 1996 Association of human protein-tyrosine phosphatase kappa with members of the armadillo family.
8264577 1994 Receptor tyrosine phosphatase R-PTP-kappa mediates homophilic binding.
7782276 1995 Homophilic interactions mediated by receptor tyrosine phosphatases mu and kappa. A critical role for the novel extracellular MAM domain.