Property Summary

NCBI Gene PubMed Count 42
PubMed Score 43.52
PubTator Score 43.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
astrocytic glioma 1.700 2.6e-02
ependymoma 2.300 4.0e-03
oligodendroglioma 1.700 8.6e-03
osteosarcoma 2.771 2.7e-07
atypical teratoid / rhabdoid tumor 1.100 4.0e-04
medulloblastoma 1.100 2.2e-02
medulloblastoma, large-cell 1.300 1.4e-04
acute quadriplegic myopathy 1.670 7.4e-06
adrenocortical carcinoma -1.249 8.5e-03
non-small cell lung cancer -1.281 1.8e-12
lung cancer -1.800 1.7e-03
active Crohn's disease 1.192 7.3e-03
ulcerative colitis 1.700 1.2e-07
Breast cancer 3.100 2.7e-02
interstitial cystitis 1.500 2.9e-04
pilocytic astrocytoma 1.200 1.2e-03
aldosterone-producing adenoma -1.118 1.5e-02
subependymal giant cell astrocytoma 2.198 1.7e-02
Pick disease 1.900 1.2e-07
progressive supranuclear palsy 1.500 5.6e-03
gastric carcinoma 1.600 2.0e-02
ductal carcinoma in situ -1.100 6.9e-03
invasive ductal carcinoma -1.900 2.9e-03
ovarian cancer 2.500 4.2e-05
pituitary cancer -1.700 4.5e-03
cystic fibrosis and chronic rhinosinusit... 1.172 2.5e-02

Pathway (1)

Gene RIF (22)

PMID Text
25775014 Results demonstrate that PTPRG plasmatic form (sPTPRG) represent a novel candidate protein biomarker in plasma whose increased expression is associated to hepatocyte damage.
25624455 PTPRG is a JAK2 phosphatase that negatively regulates leukocyte integrin beta2 activation.
25299301 SNPs in PTPRG were not associated with FCD in Caucasians.
25196286 Germline polymorphisms in PTPRG gene is associated with lung adenocarcinoma.
25158255 Mutations in PDGFRB cause infantile myofibromatosis while a mutation in PTPRG may act as an aggravating factor.
24496747 PTPRG expression induces dephosphorylation of ERK, a downstream RAS target that may be critical for mutant RAS-induced cell growth.
23758498 Our results showed that there was no significant association between any of five reported SNPs of TCF4 and PTPRG genes and the occurrence of Fuchs' endothelial dystrophy; only rs7640737 in PTPRG showed an increased risk for corneal dystrophy.
21795790 found that the RPTP-gamma, RPTP-gamma(V948I, S970T) and RPTP-gamma(C858S, S970T) proteins could be stored at 193 K in their respective crystallization buffers without affecting crystallization or crystal quality
21150880 Tumor-specific methylation of the first intron of the receptor protein-tyrosine phosphatase gamma gene was found in both sporadic and Lynch syndrome colorectal cancers.
20959494 Downregulation of Protein tyrosine phosphatase receptor type {gamma} is associated with chronic myeloid leukemia.
20651337 PTPRG inhibited breast tumor formation in vivo; PTPRG may up-regulate p21(cip) and p27(kip) proteins through the ERK1/2 pathway.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20133774 findings implicate PTPRG, PTPRZ and CNTNs as a group of receptors and ligands involved in the manifold recognition events that underlie the construction of neural networks
19567891 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18829573 PTPRG may contribute to tumorigenesis.
18646686 There were significant differences of PTPRG gene methylation and PTPRG mRNA expression between gastric primary cancer and lymph node metastases.
17963294 Significant difference exists in methylation of gene PTPRG between primary tumor and metastatic lymph nodes of gastric cancer.
15897551 Promoter hypermethylation of PTPRG is associated with cutaneous T-cell lymphoma
14676845 PTPgamma may function as an important modulator in regulating the process of tumorigenesis in human breast.
12553013 Estrogenic down-regulation of protein tyrosine phosphatase gamma (PTP gamma) in human breast is associated with estrogen receptor alpha.
11859871 both estradiol-17beta and zeranol regulate PTPgamma expression in human breast; epithelial-stromal cell interaction is important in regulation of PTPgamma expression by estrogenically active agents

AA Sequence

MRRLLEPCWWILFLKITSSVLHYVVCFPALTEGYVGALHENRHGSAVQIRRRKASGDPYWAYSGAYGPEH      1 - 70
WVTSSVSCGGRHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNTGKTVAILLKDDYFVSGAGLP     71 - 140
GRFKAEKVEFHWGHSNGSAGSEHSINGRRFPVEMQIFFYNPDDFDSFQTAISENRIIGAMAIFFQVSPRD    141 - 210
NSALDPIIHGLKGVVHHEKETFLDPFVLRDLLPASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQ    211 - 280
LEAFYSIFTTEQQDHVKSVEYLRNNFRPQQRLHDRVVSKSAVRDSWNHDMTDFLENPLGTEASKVCSSPP    281 - 350
IHMKVQPLNQTALQVSWSQPETIYHPPIMNYMISYSWTKNEDEKEKTFTKDSDKDLKATISHVSPDSLYL    351 - 420
FRVQAVCRNDMRSDFSQTMLFQANTTRIFQGTRIVKTGVPTASPASSADMAPISSGSSTWTSSGIPFSFV    421 - 490
SMATGMGPSSSGSQATVASVVTSTLLAGLGFGGGGISSFPSTVWPTRLPTAASASKQAARPVLATTEALA    491 - 560
SPGPDGDSSPTKDGEGTEEGEKDEKSESEDGEREHEEDGEKDSEKKEKSGVTHAAEERNQTEPSPTPSSP    561 - 630
NRTAEGGHQTIPGHEQDHTAVPTDQTGGRRDAGPGLDPDMVTSTQVPPTATEEQYAGSDPKRPEMPSKKP    631 - 700
MSRGDRFSEDSRFITVNPAEKNTSGMISRPAPGRMEWIIPLIVVSALTFVCLILLIAVLVYWRGCNKIKS    701 - 770
KGFPRRFREVPSSGERGEKGSRKCFQTAHFYVEDSSSPRVVPNESIPIIPIPDDMEAIPVKQFVKHIGEL    771 - 840
YSNNQHGFSEDFEEVQRCTADMNITAEHSNHPENKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINAN    841 - 910
YVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRKCDQYWPTENSEEYGNIIVTL    911 - 980
KSTKIHACYTVRRFSIRNTKVKKGQKGNPKGRQNERVVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARM    981 - 1050
PETGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAI   1051 - 1120
LGKETEVSSNQLHSYVNSILIPGVGGKTRLEKQFKLVTQCNAKYVECFSAQKECNKEKNRNSSVVPSERA   1121 - 1190
RVGLAPLPGMKGTDYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEF   1191 - 1260
VYWPSREESMNCEAFTVTLISKDRLCLSNEEQIIIHDFILEATQDDYVLEVRHFQCPKWPNPDAPISSTF   1261 - 1330
ELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQQLENENAVDVFQVAKMINLMRPGVFTDIEQY   1331 - 1400
QFIYKAMLSLVSTKENGNGPMTVDKNGAVLIADESDPAESMESLV                            1401 - 1445
//

Text Mined References (46)

PMID Year Title
25775014 2015 Identification of protein tyrosine phosphatase receptor gamma extracellular domain (sPTPRG) as a natural soluble protein in plasma.
25624455 2015 Protein tyrosine phosphatase receptor type ? is a JAK phosphatase and negatively regulates leukocyte integrin activation.
25299301 2014 Association of common variants in TCF4 and PTPRG with Fuchs' corneal dystrophy: a systematic review and meta-analysis.
25196286 2015 Germline polymorphisms and survival of lung adenocarcinoma patients: a genome-wide study in two European patient series.
25158255 2014 Modulation of expressivity in PDGFRB-related infantile myofibromatosis: a role for PTPRG?
24496747 2014 PTPRG inhibition by DNA methylation and cooperation with RAS gene activation in childhood acute lymphoblastic leukemia.
23758498 2014 Association of transcription factor 4 (TCF4) and protein tyrosine phosphatase, receptor type G (PTPRG) with corneal dystrophies in southern Chinese.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
21926974 2011 Genome-wide association study identifies five new schizophrenia loci.
21795790 2011 Cloning, purification, crystallization and preliminary X-ray analysis of the catalytic domain of human receptor-like protein tyrosine phosphatase ? in three different crystal forms.
21724833 2011 Identification of PTPN23 as a novel regulator of cell invasion in mammary epithelial cells from a loss-of-function screen of the 'PTP-ome'.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21150880 2011 Tumour-specific methylation of PTPRG intron 1 locus in sporadic and Lynch syndrome colorectal cancer.
21112398 2011 Receptor tyrosine phosphatase PTP? is a regulator of spinal cord neurogenesis.
20959494 2010 Protein tyrosine phosphatase receptor type {gamma} is a functional tumor suppressor gene specifically downregulated in chronic myeloid leukemia.
20825314 2010 E2-2 protein and Fuchs's corneal dystrophy.
20651337 2010 Function and regulatory mechanisms of the candidate tumor suppressor receptor protein tyrosine phosphatase gamma (PTPRG) in breast cancer cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20133774 2010 The protein tyrosine phosphatases PTPRZ and PTPRG bind to distinct members of the contactin family of neural recognition molecules.
20125088 2011 Genome-wide association study of recurrent early-onset major depressive disorder.
20031603 2009 A genome-wide association scan of RR and QT interval duration in 3 European genetically isolated populations: the EUROSPAN project.
19567891 2009 Genetic utility of broadly defined bipolar schizoaffective disorder as a diagnostic concept.
19167335 2009 Large-scale structural analysis of the classical human protein tyrosine phosphatome.
18829573 2008 Functional analysis of a cell cycle-associated, tumor-suppressive gene, protein tyrosine phosphatase receptor type G, in nasopharyngeal carcinoma.
18646686 2008 [Methylation of PTPRG gene and its regulation in gastric cancer].
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17963294 2007 Metastatic suppressor genes inactivated by aberrant methylation in gastric cancer.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15897551 2005 Epigenetic profiling of cutaneous T-cell lymphoma: promoter hypermethylation of multiple tumor suppressor genes including BCL7a, PTPRG, and p73.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14676845 2004 Function analysis of estrogenically regulated protein tyrosine phosphatase gamma (PTPgamma) in human breast cancer cell line MCF-7.
12553013 Estrogenic down-regulation of protein tyrosine phosphatase gamma (PTP gamma) in human breast is associated with estrogen receptor alpha.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10521598 1999 Protein tyrosine phosphatase zeta/RPTPbeta interacts with PSD-95/SAP90 family.
10376795 1999 Reduced expression of protein tyrosine phosphatase gamma in lung and ovarian tumors.
8833149 1996 Structure of the human receptor tyrosine phosphatase gamma gene (PTPRG) and relation to the familial RCC t(3;8) chromosome translocation.
8382771 1993 Identification of a carbonic anhydrase-like domain in the extracellular region of RPTP gamma defines a new subfamily of receptor tyrosine phosphatases.
7683956 1993 A MspI polymorphism and linkage mapping of the human protein-tyrosine phosphatase G (PTPRG) gene.
2170109 1990 Structural diversity and evolution of human receptor-like protein tyrosine phosphatases.
2169617 1990 Cloning of three human tyrosine phosphatases reveals a multigene family of receptor-linked protein-tyrosine-phosphatases expressed in brain.
1711217 1991 Receptor protein-tyrosine phosphatase gamma is a candidate tumor suppressor gene at human chromosome region 3p21.