Property Summary

NCBI Gene PubMed Count 42
PubMed Score 48.62
PubTator Score 18.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -4.200 7.1e-09
osteosarcoma -1.745 5.8e-03
posterior fossa group A ependymoma -1.500 1.1e-08
group 4 medulloblastoma -2.500 6.2e-10
atypical teratoid / rhabdoid tumor -1.800 4.5e-06
medulloblastoma, large-cell -2.400 1.2e-05
tuberculosis 1.100 1.2e-03
non-small cell lung cancer -1.420 3.8e-12
interstitial cystitis 1.100 2.3e-03
pilocytic astrocytoma 1.800 8.5e-09
primary Sjogren syndrome 1.200 8.2e-04
Breast cancer -1.300 5.1e-06
psoriasis 1.200 1.5e-13
lung carcinoma -2.100 1.1e-28
gastric carcinoma 1.400 1.8e-02
ovarian cancer -2.500 9.3e-12
pituitary cancer -1.400 1.5e-03

Gene RIF (14)

PMID Text
22117074 Epidermal growth factor receptor (EGFR)-mediated positive feedback of protein-tyrosine phosphatase epsilon (PTPepsilon) on ERK1/2 and AKT protein pathways is required for survival of human breast cancer cells.
21734400 Studies indicate that RAD50 and PTPRE of crude associations with asthma at a Bonferroni-corrected level of significance, while IL4R, CCL5 and TBXA2R of nominal significance.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20174665 Screening in Jurkat T-cells with a short-hairpin-RNA (shRNA) library identifies PTPRE, a member of the protein tyrosine phosphatase family, is important for HIV-1 replication
18682798 Observational study of gene-disease association. (HuGE Navigator)
18093973 Protein-tyrosine phosphatase epsilon regulates Shc signaling in a kinase-specific manner: increasing coherence in tyrosine phosphatase signaling
16385451 Observational study of gene-disease association. (HuGE Navigator)
15390114 Transgenic mice overexpressing catalytically inactive transmembrane protein tyrosine phosphatase epsilon provide unexpected insight into the cell-cell interactions that occur between oligodendrocytes and the cells which they myelinate.
12861030 cyt-PTP epsilon is dimerized and phosphorylated in the absence of direct interaction between the PTP and extracellular molecules
12754301 Functions to prevent inappropriate activation and to terminate prolonged, rather than acute, activation of ERK in the cytosol.
12376545 interactions between RPTP-domain1s and RPTP-domain 2s are a common but specific mechanism that is likely to be regulated- domain2s and the wedge structures are crucial determinants of binding specificity, thus regulating cross-talk between RPTPs
12193229 Characterization, expression and functional aspects of an alternative spliced isoform of protein tyrosine phosphatase epsilon
12121439 Transfection of cells with different PTPepsilon constructs and activator protein-1 reporter gene indicates that the catalytic activity of PTPepsilon is involved in the regulation of the mitogen-activated protein kinase cascade.

AA Sequence

MEPLCPLLLVGFSLPLARALRGNETTADSNETTTTSGPPDPGASQPLLAWLLLPLLLLLLVLLLAAYFFR      1 - 70
FRKQRKAVVSTSDKKMPNGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLEEEIRIRSADDCKQFREEFN     71 - 140
SLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVILSQLDGIPCSDYINASYIDGYKEKNKFIAAQGP    141 - 210
KQETVNDFWRMVWEQKSATIVMLTNLKERKEEKCHQYWPDQGCWTYGNIRVCVEDCVVLVDYTIRKFCIQ    211 - 280
PQLPDGCKAPRLVSQLHFTSWPDFGVPFTPIGMLKFLKKVKTLNPVHAGPIVVHCSAGVGRTGTFIVIDA    281 - 350
MMAMMHAEQKVDVFEFVSRIRNQRPQMVQTDMQYTFIYQALLEYYLYGDTELDVSSLEKHLQTMHGTTTH    351 - 420
FDKIGLEEEFRKLTNVRIMKENMRTGNLPANMKKARVIQIIPYDFNRVILSMKRGQEYTDYINASFIDGY    421 - 490
RQKDYFIATQGPLAHTVEDFWRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTL    491 - 560
SEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGIPAEGKGMIDLIAAVQKQQQQTGNHPITVHC    561 - 630
SAGAGRTGTFIALSNILERVKAEGLLDVFQAVKSLRLQRPHMVQTLEQYEFCYKVVQDFIDIFSDYANFK    631 - 700
//

Text Mined References (46)

PMID Year Title
25772781 2015 Linkage and association analysis of obesity traits reveals novel loci and interactions with dietary n-3 fatty acids in an Alaska Native (Yup'ik) population.
23440723 2013 Deregulation of protein phosphatase expression in acute myeloid leukemia.
22952603 2012 Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13).
22117074 2012 Epidermal growth factor receptor (EGFR)-mediated positive feedback of protein-tyrosine phosphatase epsilon (PTPepsilon) on ERK1/2 and AKT protein pathways is required for survival of human breast cancer cells.
21734400 2011 Attempted replication of 50 reported asthma risk genes identifies a SNP in RAD50 as associated with childhood atopic asthma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19167335 2009 Large-scale structural analysis of the classical human protein tyrosine phosphatome.
18682798 2008 Genes to diseases (G2D) computational method to identify asthma candidate genes.
18093973 2008 Protein-tyrosine phosphatase epsilon regulates Shc signaling in a kinase-specific manner: increasing coherence in tyrosine phosphatase signaling.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17903293 2007 Genome-wide association with select biomarker traits in the Framingham Heart Study.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15845350 2005 Src kinase regulation by phosphorylation and dephosphorylation.
15738637 2005 Receptor-type protein tyrosine phosphatase epsilon (PTPepsilonM) is a negative regulator of insulin signaling in primary hepatocytes and liver.
15588985 2005 Substrate-trapping techniques in the identification of cellular PTP targets.
15522235 2004 Tyrosine phosphatase epsilonM stimulates migration and survival of porcine aortic endothelial cells by activating c-Src.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15390114 2004 Expression of a catalytically inactive transmembrane protein tyrosine phosphatase epsilon (tm-PTP epsilon) delays optic nerve myelination.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14980517 2004 Protein tyrosine phosphatase epsilon activates Yes and Fyn in Neu-induced mammary tumor cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12861030 2003 Dimerization in vivo and inhibition of the nonreceptor form of protein tyrosine phosphatase epsilon.
12754301 2003 Protein tyrosine phosphatase epsilon inhibits signaling by mitogen-activated protein kinases.
12615930 2003 Phosphorylation-dependent regulation of Kv2.1 Channel activity at tyrosine 124 by Src and by protein-tyrosine phosphatase epsilon.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376545 2002 Intra- and intermolecular interactions between intracellular domains of receptor protein-tyrosine phosphatases.
12193229 2002 Characterization, expression and functional aspects of a novel protein tyrosine phosphatase epsilon isoform.
12121439 2002 Expression of human protein tyrosine phosphatase epsilon in leucocytes: a potential ERK pathway-regulating phosphatase.
10980613 2000 Generation of novel cytoplasmic forms of protein tyrosine phosphatase epsilon by proteolytic processing and translational control.
10921884 2000 Hypomyelination and increased activity of voltage-gated K(+) channels in mice lacking protein tyrosine phosphatase epsilon.
10859312 2000 Protein-tyrosine phosphatase PTPepsilon C inhibits Jak-STAT signaling and differentiation induced by interleukin-6 and leukemia inhibitory factor in M1 leukemia cells.
10490839 1999 The transmembranal and cytoplasmic forms of protein tyrosine phosphatase epsilon physically associate with the adaptor molecule Grb2.
9914474 1999 Distinct promoters control transmembrane and cytosolic protein tyrosine phosphatase epsilon expression during macrophage differentiation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8838320 1996 The protein tyrosine phosphatase epsilon gene maps to mouse chromosome 7 and human chromosome 10q26.
8786123 1996 Development of a screening set for new (CAG/CTG)n dynamic mutations.
8618876 1995 Identification of a cytoplasmic, phorbol ester-inducible isoform of protein tyrosine phosphatase epsilon.
8610169 1996 Protein-tyrosine phosphatase activity regulates osteoclast formation and function: inhibition by alendronate.
8595895 1995 Assignment of the human protein tyrosine phosphatase epsilon (PTPRE) gene to chromosome 10q26 by fluorescence in situ hybridization.
8586417 1995 Monitoring cell physiology by expression profiles and discovering cell type-specific genes by compiled expression profiles.
7835887 1994 Chromosomal assignments of 3'-directed partial cDNA sequences representing novel genes expressed in granulocytoid cells.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.
2170109 1990 Structural diversity and evolution of human receptor-like protein tyrosine phosphatases.