Property Summary

NCBI Gene PubMed Count 76
PubMed Score 186.06
PubTator Score 78.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (25)

Disease log2 FC p
malignant mesothelioma 5.000 8.0e-10
psoriasis -2.600 5.1e-03
glioblastoma -2.400 2.1e-03
osteosarcoma 2.259 1.9e-02
posterior fossa group B ependymoma -2.000 6.6e-07
atypical teratoid / rhabdoid tumor 1.500 3.4e-02
group 4 medulloblastoma -1.400 1.7e-03
medulloblastoma, large-cell -2.200 5.2e-03
ulcerative colitis -1.014 1.3e-02
autosomal dominant Emery-Dreifuss muscul... 1.230 6.1e-03
intraductal papillary-mucinous adenoma (... -2.400 4.9e-04
Hydrolethalus syndrome -1.094 4.8e-02
colon cancer -2.800 1.0e-02
lung cancer -3.500 5.4e-06
interstitial cystitis -1.200 3.5e-03
lung adenocarcinoma -1.225 8.0e-08
pediatric high grade glioma -2.000 4.3e-04
subependymal giant cell astrocytoma -3.678 3.6e-03
Breast cancer 1.200 2.8e-02
non-small cell lung carcinoma -1.300 6.4e-29
acute myeloid leukemia -1.200 6.7e-03
ovarian cancer -1.500 1.3e-03
pituitary cancer -2.000 1.1e-02
Down syndrome 1.100 4.0e-03
facioscapulohumeral dystrophy 1.800 3.0e-02

 CSPA Cell Line (2)

Protein-protein Interaction (1)

Gene RIF (49)

PMID Text
26425837 PTPRD was identified as a novel locus potentially associated with blood pressure response to atenolol and resistant hypertension in multiple ethnic groups.
26267899 PTPRD mutation, but not methylation or copy number loss, may serve as a predictive biomarker of sensitivity to STAT3 inhibitors in HNSCC.
26079428 Study shows for the first time that DNMT1 caused PTPRD DNA hypermethylation and induced insulin signaling silencing in T2D patients.
25831062 PTPRD is homozygously deleted and epigenetically downregulated in hepatocellular carcinomas (HCCs).
25412184 Silencing PTPRD expression by siRNA treatment significantly enhanced cell proliferation compared with mock siRNA treatment.
25345593 This study demonstrated that the copy number variations of PTPRD relate to opioid dependence.
25287652 The absence of MIM led to PTPdelta-mediated activation of SRC.
25142570 Periodic leg movements during sleep are associated with polymorphisms in BTBD9, TOX3/BC034767, MEIS1, MAP2K5/SKOR1, and PTPRD
25138050 Ptprd is a tumor suppressor that can promote tumorigenesis in concert with Cdkn2a loss.
25113440 we report desmoplakin, a desmosomal protein that is implicated in cell-cell adhesion, as a novel PTPRD substrate.
24843164 We reveal that PTPRD is a bona fide tumor suppressor, pinpoint PTPRD loss as a cause of aberrant STAT3 activation in gliomas, and establish PTPRD loss, in the setting of CDKN2A/p16(INK4A) deletion, as a driver of glioma progression.
23991058 Data indicate that expression of several predicted chimeric genes and genes with disrupted exon structure including ALK, NBAS, FHIT, PTPRD and ODZ4 in neuroblastoma.
23800680 Data suggest that PTPRD germline mutations may play a role in the development of Ewing sarcoma.
23404381 Loss of PTPRD gene is associated with squamous cell carcinomas of the vulva.
23147557 Diabetes risk alleles in PPARG2(rs1801282) and PTPRD (rs17584499) are associated with pioglitazone therapeutic efficacy.
23069849 Polymorphism in protein tyrosine phosphatase receptor delta is associated with the risk of clear cell renal cell carcinoma.
22571343 Although endogenous PTPdelta expression was very low in neuroblastoma cells, it was also low in mouse embryo adrenal glands, suggesting that PTPdelta may have little developmental function in early adrenal neuroblasts.
22305495 PTPRD has a tumor suppressor function in neuroblastoma through AURKA dephosphorylation and destabilization and a downstream destabilization of MYCN protein, representing a novel mechanism for the function of PTPRD in neuroblastoma.
22052591 This is the first report to observe an association between deletion within PTPRD and metastatic cutaneous squamous cell carcinoma.
21926414 The interaction of the IL1RAPL1 family of proteins with PTPdelta and RhoGAP2 reveals a pathophysiological mechanism of cognitive impairment associated with a novel type of trans-synaptic signaling.
21767287 Data indicate that genetic variants near the KCNQ1 and MAF/WWOX genes are associated with reduced insulin secretion, and the PTPRD genetic variant appears to be associated with progression to diabetes in Han Chinese.
21493956 Eight suggestive significant loci were detected with a series of genes expressed within the inner ear that underlie the auditory function, such as: DCLK1, PTPRD, GRM8, CMIP.
21264940 Both family-based and population-based association studies suggest that PTPRD variant rs1975197 confers risk of RLS.
21213369 statistical significant downregulation of PCDH17/PCH68 and PTPRD was observed
20816195 Observational study of gene-disease association. (HuGE Navigator)
20808825 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20200953 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20174558 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20139422 Trans-synaptic adhesions between netrin-G ligand-3 (NGL-3) and receptor tyrosine phosphatases LAR, protein-tyrosine phosphatase delta (PTPdelta), and PTPsigma via specific domains regulate excitatory synapse formation.
20073072 Results found the PTPRD gene was most frequently homozygously deleted gene in human lung cancer among genes mapping to regions other than 9p21.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19525478 Identification of ZNF366 and PTPRD as novel determinants of plasma homocysteine in a family-based genome-wide association study
19525478 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19500277 No mutations of PTPRD were associated with familiar melanoma
19478061 These results implicate PTPRD as a tumor suppressor on chromosome 9p that is involved in the development of glioblastoma multiforme and multiple human cancers.
19478061 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
18660810 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18660810 Two independent SNPs in the 5' UTR of splice variants expressed predominantly in the central nervous system showed highly significant P values, identifying PTPRD as the fourth genome-wide significant locus for restless legs syndrome.
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18414509 The results indicate that polymorphisms of PTPRD are strongly associated with pediatric bronchial asthma in the Taiwanese population.
18414509 Observational study of gene-disease association. (HuGE Navigator)
18050303 The aberrant splicing or microdeletion of 5' UTR exons in such a high proportion of tumors indicates that loss of these exons dys-regulates the mRNA sequence
17420988 data identify PTPRD as a candidate tumor suppressor gene in cutaneous squamous cell carcinoma with a possible association with metastasis
16114034 A novel isoform of PTPRD was cloned and its expression analyzed.
12376545 interactions between RPTP-domain1s and RPTP-domain 2s are a common but specific mechanism that is likely to be regulated- domain2s and the wedge structures are crucial determinants of binding specificity, thus regulating cross-talk between RPTPs

AA Sequence

MVHVARLLLLLLTFFLRTDAETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFE      1 - 70
VIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLREDQIPRGFPTIDMGPQLKVVERT     71 - 140
RTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKYECVAT    141 - 210
NSAGTRYSAPANLYVRELREVRRVPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPED    211 - 280
DMPIGRNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWDSGNPEP    281 - 350
VSYYIIQHKPKNSEELYKEIDGVATTRYSVAGLSPYSDYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSSA    351 - 420
PRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSV    421 - 490
KVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPRSDTIANYELVYKDGEHGEEQ    491 - 560
RITIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQSKPSAPPQDISCTSPSSTSILVSW    561 - 630
QPPPVEKQNGIITEYSIKYTAVDGEDDKPHEILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESL    631 - 700
SVLIRTNEDVPSGPPRKVEVEAVNSTSVKVSWRSPVPNKQHGQIRGYQVHYVRMENGEPKGQPMLKDVML    701 - 770
ADAQWEFDDTTEHDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTGAVPGKPRLVINHTQMNTAL    771 - 840
IQWHPPVDTFGPLQGYRLKFGRKDMEPLTTLEFSEKEDHFTATDIHKGASYVFRLSARNKVGFGEEMVKE    841 - 910
ISIPEEVPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGIITKYTLLYRDINIPLLPMEQLIVPADTTMT    911 - 980
LTGLKPDTTYDVKVRAHTSKGPGPYSPSVQFRTLPVDQVFAKNFHVKAVMKTSVLLSWEIPENYNSAMPF    981 - 1050
KILYDDGKMVEEVDGRATQKLIVNLKPEKSYSFVLTNRGNSAGGLQHRVTAKTAPDVLRTKPAFIGKTNL   1051 - 1120
DGMITVQLPEVPANENIKGYYIIIVPLKKSRGKFIKPWESPDEMELDELLKEISRKRRSIRYGREVELKP   1121 - 1190
YIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPI   1191 - 1260
TDEEEGLIWVVGPVLAVVFIICIVIAILLYKRKRAESDSRKSSIPNNKEIPSHHPTDPVELRRLNFQTPG   1261 - 1330
MASHPPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLS   1331 - 1400
AIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWP   1401 - 1470
SRGTETHGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKT   1471 - 1540
CNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALL   1541 - 1610
EAVTCGNTEVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMP   1611 - 1680
YESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMG   1681 - 1750
REKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGF   1751 - 1820
IDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTE   1821 - 1890
DQYQFSYRAALEYLGSFDHYAT                                                   1891 - 1912
//

Text Mined References (80)

PMID Year Title
26425837 2015 PTPRD gene associated with blood pressure response to atenolol and resistant hypertension.
26267899 2015 Loss-of-Function PTPRD Mutations Lead to Increased STAT3 Activation and Sensitivity to STAT3 Inhibition in Head and Neck Cancer.
26079428 2015 PTPRD silencing by DNA hypermethylation decreases insulin receptor signaling and leads to type 2 diabetes.
25831062 2015 PTPRD is homozygously deleted and epigenetically downregulated in human hepatocellular carcinomas.
25412184 2014 Reduced expression of PTPRD correlates with poor prognosis in gastric adenocarcinoma.
25345593 2015 Genome-wide association study of copy number variations (CNVs) with opioid dependence.
25287652 2015 Missing-in-Metastasis regulates cell motility and invasion via PTP?-mediated changes in SRC activity.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25142570 2014 Periodic leg movements during sleep are associated with polymorphisms in BTBD9, TOX3/BC034767, MEIS1, MAP2K5/SKOR1, and PTPRD.
25138050 2014 Deletion of Ptprd and Cdkn2a cooperate to accelerate tumorigenesis.
25113440 2014 Mutational and functional analysis of the tumor-suppressor PTPRD in human melanoma.
24843164 2014 Loss of the tyrosine phosphatase PTPRD leads to aberrant STAT3 activation and promotes gliomagenesis.
24821223 2015 Genome-wide association study in obsessive-compulsive disorder: results from the OCGAS.
24811271 2014 Genome-wide SNP associations with rubella-specific cytokine responses in measles-mumps-rubella vaccine recipients.
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24047446 2013 Genome-wide association study of co-occurring anxiety in major depression.
23991058 2013 Breakpoint features of genomic rearrangements in neuroblastoma with unbalanced translocations and chromothripsis.
23962720 2014 A genome-wide association study and biological pathway analysis of epilepsy prognosis in a prospective cohort of newly treated epilepsy.
23903073 2013 Genome-wide association study of the five-factor model of personality in young Korean women.
23800680 2013 Germline PTPRD mutations in Ewing sarcoma: biologic and clinical implications.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23404381 2013 Genomic aberration patterns and expression profiles of squamous cell carcinomas of the vulva.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23147557 2013 PPAR-?2 and PTPRD gene polymorphisms influence type 2 diabetes patients' response to pioglitazone in China.
23069849 2013 Polymorphism in protein tyrosine phosphatase receptor delta is associated with the risk of clear cell renal cell carcinoma.
23049088 2012 A genome-wide association study provides evidence for association of chromosome 8p23 (MYP10) and 10q21.1 (MYP15) with high myopia in the French Population.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
22832960 2012 A genome-wide meta-analysis of association studies of Cloninger's Temperament Scales.
22571343 2012 Functional analysis of the putative tumor suppressor PTPRD in neuroblastoma cells.
22305495 2012 Protein tyrosine phosphatase receptor delta acts as a neuroblastoma tumor suppressor by destabilizing the aurora kinase A oncogene.
22052591 2012 Metastatic cutaneous squamous cell carcinoma shows frequent deletion in the protein tyrosine phosphatase receptor Type D gene.
21926414 2011 The X-linked intellectual disability protein IL1RAPL1 regulates excitatory synapse formation by binding PTP? and RhoGAP2.
21779176 2011 Genome-wide association study identifies novel restless legs syndrome susceptibility loci on 2p14 and 16q12.1.
21767287 2012 Replication of genome-wide association signals of type 2 diabetes in Han Chinese in a prospective cohort.
21647700 2011 Genome-wide association and meta-analysis in populations from Starr County, Texas, and Mexico City identify type 2 diabetes susceptibility loci and enrichment for expression quantitative trait loci in top signals.
21493956 2011 Hearing function and thresholds: a genome-wide association study in European isolated populations identifies new loci and pathways.
21264940 2011 Family-based and population-based association studies validate PTPRD as a risk factor for restless legs syndrome.
21213369 2011 High resolution ArrayCGH and expression profiling identifies PTPRD and PCDH17/PCH68 as tumor suppressor gene candidates in laryngeal squamous cell carcinoma.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20808825 2010 Novel association strategy with copy number variation for identifying new risk Loci of human diseases.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20526338 2010 Genome-wide meta-analyses identifies seven loci associated with platelet aggregation in response to agonists.
20522523 2010 Common genetic variation and susceptibility to partial epilepsies: a genome-wide association study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20200953 2010 Genome-wide pleiotropy of osteoporosis-related phenotypes: the Framingham Study.
20174558 2010 A genome-wide association study identifies susceptibility variants for type 2 diabetes in Han Chinese.
20139422 2010 Trans-synaptic adhesions between netrin-G ligand-3 (NGL-3) and receptor tyrosine phosphatases LAR, protein-tyrosine phosphatase delta (PTPdelta), and PTPsigma via specific domains regulate excitatory synapse formation.
20073072 2010 A catalog of genes homozygously deleted in human lung cancer and the candidacy of PTPRD as a tumor suppressor gene.
19921088 2010 Cytokine receptor-like factor 1 is highly expressed in damaged human knee osteoarthritic cartilage and involved in osteoarthritis downstream of TGF-beta.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19525478 2009 Identification of ZNF366 and PTPRD as novel determinants of plasma homocysteine in a family-based genome-wide association study.
19500277 2009 Lack of inherited mutations of PTPRD in familial melanoma and melanoma-astrocytoma syndrome.
19478061 2009 The tyrosine phosphatase PTPRD is a tumor suppressor that is frequently inactivated and mutated in glioblastoma and other human cancers.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
18660810 2008 PTPRD (protein tyrosine phosphatase receptor type delta) is associated with restless legs syndrome.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18414509 2008 The polymorphisms of protein-tyrosine phosphatase receptor-type delta gene and its association with pediatric asthma in the Taiwanese population.
18050303 2008 Aberrant splicing of the PTPRD gene mimics microdeletions identified at this locus in neuroblastomas.
17420988 2007 Allelic imbalances and microdeletions affecting the PTPRD gene in cutaneous squamous cell carcinomas detected using single nucleotide polymorphism microarray analysis.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16114034 2005 Identification of chromosome arm 9p as the most frequent target of homozygous deletions in lung cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14759258 2004 An unappreciated role for RNA surveillance.
12570871 2003 MIM-B, a putative metastasis suppressor protein, binds to actin and to protein tyrosine phosphatase delta.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376545 2002 Intra- and intermolecular interactions between intracellular domains of receptor protein-tyrosine phosphatases.
9624153 1998 Liprins, a family of LAR transmembrane protein-tyrosine phosphatase-interacting proteins.
9566880 1998 The second catalytic domain of protein tyrosine phosphatase delta (PTP delta) binds to and inhibits the first catalytic domain of PTP sigma.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8524829 1995 The LAR/PTP delta/PTP sigma subfamily of transmembrane protein-tyrosine-phosphatases: multiple human LAR, PTP delta, and PTP sigma isoforms are expressed in a tissue-specific manner and associate with the LAR-interacting protein LIP.1.
8355697 1993 MPTP delta, a putative murine homolog of HPTP delta, is expressed in specialized regions of the brain and in the B-cell lineage.
7896816 1995 Molecular characterization of the human transmembrane protein-tyrosine phosphatase delta. Evidence for tissue-specific expression of alternative human transmembrane protein-tyrosine phosphatase delta isoforms.
7665159 1995 The mouse gene Ptprf encoding the leukocyte common antigen-related molecule LAR: cloning, characterization, and chromosomal localization.
2170109 1990 Structural diversity and evolution of human receptor-like protein tyrosine phosphatases.