Property Summary

Ligand Count 36
NCBI Gene PubMed Count 44
PubMed Score 118.06
PubTator Score 51.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute myeloid leukemia -1.400 3.5e-02
adrenocortical carcinoma -1.073 7.6e-06
adult high grade glioma -1.100 8.3e-03
atypical teratoid/rhabdoid tumor -1.100 2.9e-02
Breast cancer 1.300 1.2e-05
breast carcinoma -1.100 1.5e-12
cystic fibrosis 1.623 1.6e-04
ductal carcinoma in situ -1.300 8.2e-04
invasive ductal carcinoma -1.300 6.4e-03
lung adenocarcinoma -2.200 6.9e-16
lung cancer -2.100 5.0e-04
lung carcinoma -2.500 2.8e-13
medulloblastoma, large-cell -1.500 2.2e-03
nephrosclerosis 1.091 2.3e-03
non-small cell lung cancer -2.488 1.3e-21
osteosarcoma -1.627 9.9e-05
pancreatic ductal adenocarcinoma liver m... -2.160 1.2e-03

 CSPA Cell Line (3)

PDB (12)

Gene RIF (17)

AA Sequence

MLSHGAGLALWITLSLLQTGLAEPERCNFTLAESKASSHSVSIQWRILGSPCNFSLIYSSDTLGAALCPT      1 - 70
FRIDNTTYGCNLQDLQAGTIYNFRIISLDEERTVVLQTDPLPPARFGVSKEKTTSTSLHVWWTPSSGKVT     71 - 140
SYEVQLFDENNQKIQGVQIQESTSWNEYTFFNLTAGSKYNIAITAVSGGKRSFSVYTNGSTVPSPVKDIG    141 - 210
ISTKANSLLISWSHGSGNVERYRLMLMDKGILVHGGVVDKHATSYAFHGLTPGYLYNLTVMTEAAGLQNY    211 - 280
RWKLVRTAPMEVSNLKVTNDGSLTSLKVKWQRPPGNVDSYNITLSHKGTIKESRVLAPWITETHFKELVP    281 - 350
GRLYQVTVSCVSGELSAQKMAVGRTFPDKVANLEANNNGRMRSLVVSWSPPAGDWEQYRILLFNDSVVLL    351 - 420
NITVGKEETQYVMDDTGLVPGRQYEVEVIVESGNLKNSERCQGRTVPLAVLQLRVKHANETSLSIMWQTP    421 - 490
VAEWEKYIISLADRDLLLIHKSLSKDAKEFTFTDLVPGRKYMATVTSISGDLKNSSSVKGRTVPAQVTDL    491 - 560
HVANQGMTSSLFTNWTQAQGDVEFYQVLLIHENVVIKNESISSETSRYSFHSLKSGSLYSVVVTTVSGGI    561 - 630
SSRQVVVEGRTVPSSVSGVTVNNSGRNDYLSVSWLLAPGDVDNYEVTLSHDGKVVQSLVIAKSVRECSFS    631 - 700
SLTPGRLYTVTITTRSGKYENHSFSQERTVPDKVQGVSVSNSARSDYLRVSWVHATGDFDHYEVTIKNKN    701 - 770
NFIQTKSIPKSENECVFVQLVPGRLYSVTVTTKSGQYEANEQGNGRTIPEPVKDLTLRNRSTEDLHVTWS    771 - 840
GANGDVDQYEIQLLFNDMKVFPPFHLVNTATEYRFTSLTPGRQYKILVLTISGDVQQSAFIEGFTVPSAV    841 - 910
KNIHISPNGATDSLTVNWTPGGGDVDSYTVSAFRHSQKVDSQTIPKHVFEHTFHRLEAGEQYQIMIASVS    911 - 980
GSLKNQINVVGRTVPASVQGVIADNAYSSYSLIVSWQKAAGVAERYDILLLTENGILLRNTSEPATTKQH    981 - 1050
KFEDLTPGKKYKIQILTVSGGLFSKEAQTEGRTVPAAVTDLRITENSTRHLSFRWTASEGELSWYNIFLY   1051 - 1120
NPDGNLQERAQVDPLVQSFSFQNLLQGRMYKMVIVTHSGELSNESFIFGRTVPASVSHLRGSNRNTTDSL   1121 - 1190
WFNWSPASGDFDFYELILYNPNGTKKENWKDKDLTEWRFQGLVPGRKYVLWVVTHSGDLSNKVTAESRTA   1191 - 1260
PSPPSLMSFADIANTSLAITWKGPPDWTDYNDFELQWLPRDALTVFNPYNNRKSEGRIVYGLRPGRSYQF   1261 - 1330
NVKTVSGDSWKTYSKPIFGSVRTKPDKIQNLHCRPQNSTAIACSWIPPDSDFDGYSIECRKMDTQEVEFS   1331 - 1400
RKLEKEKSLLNIMMLVPHKRYLVSIKVQSAGMTSEVVEDSTITMIDRPPPPPPHIRVNEKDVLISKSSIN   1401 - 1470
FTVNCSWFSDTNGAVKYFTVVVREADGSDELKPEQQHPLPSYLEYRHNASIRVYQTNYFASKCAENPNSN   1471 - 1540
SKSFNIKLGAEMESLGGKCDPTQQKFCDGPLKPHTAYRISIRAFTQLFDEDLKEFTKPLYSDTFFSLPIT   1541 - 1610
TESEPLFGAIEGVSAGLFLIGMLVAVVALLICRQKVSHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTS   1611 - 1680
CPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVD   1681 - 1750
DDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQ   1751 - 1820
DSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDY   1821 - 1890
INRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCV   1891 - 1960
RDVLRARKLRSEQENPLFPIYENVNPEYHRDPVYSRH                                    1961 - 1997
//

Text Mined References (49)

PMID Year Title