Property Summary

NCBI Gene PubMed Count 481
PubMed Score 543.91
PubTator Score 1250.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count
Vasculitis 76
Abdominal Pain 95
Abnormal eyelashes 13
Abnormality of the hypothalamus-pituitary axis 12
Abnormality of the oral cavity 4
Alopecia 113
Angle class 2 malocclusion 57
Angle class 3 malocclusion 57
Anorexia 43
Anti-nuclear factor positive 17
Apraxias 26
Arthralgia 85
Arthritis 276
Brain Ischemia 107
C-reactive protein increased 15
Cataract 290
Cellulitis of periorbital region 13
Cerebral Ischemia 36
Chest Pain 38
Chronic Obstructive Airway Disease 33
Coughing 23
Decreased joint mobility 53
Depressive disorder 401
Diabetes Mellitus, Insulin-Dependent 48
Difficulty chewing 3
ESR raised 19
Elevated C-reactive protein level 15
Epistaxis 40
Exanthema 42
Eyebrow abnormalities 12
Fatigue 176
Fever 136
Giant cell arteritis 7
Glaucoma 232
Granulomatosis 7
Granulomatosis with polyangiitis 5
Headache 36
Hematuria 35
Hemoptysis 6
Impaired cognition 95
Infiltrate of lung 16
Inflammatory abnormality of the eye 10
Iridocyclitis 19
Joint stiffness 80
Joint swelling 25
Juvenile rheumatoid arthritis 110
Lens Opacities 227
Low Vision 167
Malocclusion 57
Mental impairment 95
Nausea and vomiting 93
Ophthalmoparesis 10
Papule 42
Paranasal Sinus Diseases 34
Pauciarticular juvenile rheumatoid arthritis 9
Periorbital edema 13
Periorbital swelling 13
Poliosis 2
Polyarthritis 11
Premature canities 24
Proteinuria 143
Pulmonary Fibrosis 101
Recurrent intrapulmonary hemorrhage 4
Recurrent respiratory infections 138
Renal glomerular disease 12
Respiratory Insufficiency 130
Respiratory function loss 119
Retinal Detachment 51
Sensorineural Hearing Loss (disorder) 281
Short stature 514
Sinusitis 63
Sparse scalp hair 41
Uveomeningoencephalitic Syndrome 3
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 6 1
Visual Impairment 167
Weight decreased 101
hypopigmented skin patch 59
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
diabetes mellitus 1683 4.653 2.3

Expression

  Differential Expression (10)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.240 1.2e-03
cutaneous lupus erythematosus 2.400 3.9e-04
ductal carcinoma in situ 1.100 2.4e-02
interstitial cystitis 2.200 4.9e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.4e-02
lung cancer -2.600 1.4e-04
lung carcinoma -3.500 1.5e-27
malignant mesothelioma -2.200 4.5e-07
primary Sjogren syndrome 1.400 1.2e-03
psoriasis 1.400 1.2e-44

Protein-protein Interaction (1)

Gene RIF (570)

AA Sequence

MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSR      1 - 70
VELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKKKCE     71 - 140
RYWAEPGEMQLEFGPFSVSCEAEKRKSDYIIRTLKVKFNSETRTIYQFHYKNWPDHDVPSSIDPILELIW    141 - 210
DVRCYQEDDSVPICIHCSAGCGRTGVICAIDYTWMLLKDGIIPENFSVFSLIREMRTQRPSLVQTQEQYE    211 - 280
LVYNAVLELFKRQMDVIRDKHSGTESQAKHCIPEKNHTLQADSYSPNLPKSTTKAAKMMNQQRTKMEIKE    281 - 350
SSSFDFRTSEISAKEELVLHPAKSSTSFDFLELNYSFDKNADTTMKWQTKAFPIVGEPLQKHQSLDLGSL    351 - 420
LFEGCSNSKPVNAAGRYFNSKVPITRTKSTPFELIQQRETKEVDSKENFSYLESQPHDSCFVEMQAQKVM    421 - 490
HVSSAELNYSLPYDSKHQIRNASNVKHHDSSALGVYSYIPLVENPYFSSWPPSGTSSKMSLDLPEKQDGT    491 - 560
VFPSSLLPTSSTSLFSYYNSHDSLSLNSPTNISSLLNQESAVLATAPRIDDEIPPPLPVRTPESFIVVEE    561 - 630
AGEFSPNVPKSLSSAVKVKIGTSLEWGGTSEPKKFDDSVILRPSKSVKLRSPKSELHQDRSSPPPPLPER    631 - 700
TLESFFLADEDCMQAQSIETYSTSYPDTMENSTSSKQTLKTPGKSFTRSKSLKILRNMKKSICNSCPPNK    701 - 770
PAESVQSNNSSSFLNFGFANRFSKPKGPRNPPPTWNI                                     771 - 807
//

Text Mined References (486)

PMID Year Title