Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.22
PubTator Score 1.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
cutaneous lupus erythematosus -1.100 5.4e-03
ependymoma -2.300 3.5e-07
glioblastoma -3.400 2.3e-06
sonic hedgehog group medulloblastoma -3.000 1.0e-05
atypical teratoid / rhabdoid tumor -3.500 1.7e-08
medulloblastoma, large-cell -2.900 2.1e-03
primitive neuroectodermal tumor -3.000 3.7e-03
pediatric high grade glioma -2.800 1.2e-06
pilocytic astrocytoma -2.600 5.0e-06
non primary Sjogren syndrome sicca -2.100 3.2e-04
Breast cancer -1.100 1.4e-02

Gene RIF (1)

PMID Text
15790311 identification of hPTPN20a as a novel and widely expressed phosphatase with a dynamic subcellular distribution that is targeted to sites of actin polymerization

AA Sequence

MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSKVFENKVNSEKVKLSLRNFPHNDYEDVF      1 - 70
EEPSESGSDPSMWTARGPFRRDRWSSEDEEAAGPSQALSPLLSDTRKIVSEGELDQLAQIRPLIFNFHEQ     71 - 140
TAIKDCLKILEEKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPLGKSKDYIN    141 - 210
ASYIRIVNCGEEYFYIATQGPLLSTIDDFWQMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELK    211 - 280
HFRVFLENYQILQYFIIRMFQVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYARKSHLTGPMV    281 - 350
VHCSAGIGRTGVFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLEVLRKLLTLD    351 - 420
//

Text Mined References (5)

PMID Year Title
22545146 2012 Pair-wise regulation of convergence and extension cell movements by four phosphatases via RhoA.
15790311 2005 Protein tyrosine phosphatase hPTPN20a is targeted to sites of actin polymerization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.