Property Summary

Ligand Count 158
NCBI Gene PubMed Count 141
PubMed Score 297.25
PubTator Score 169.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
diabetes mellitus 1728 3.934 2.0
Colitis 54 3.164 1.6
Retinitis pigmentosa 4 38 3.112 1.6

Expression

  Differential Expression (10)

Disease log2 FC p
Alzheimer's disease 1.100 2.6e-02
ependymoma 1.200 1.4e-02
glioblastoma 1.400 1.8e-04
group 3 medulloblastoma 1.300 6.0e-03
malignant mesothelioma 1.600 3.7e-05
non-small cell lung cancer -1.070 1.4e-10
osteosarcoma 2.635 7.3e-07
ovarian cancer -1.900 1.5e-10
Pick disease 1.700 1.8e-05
progressive supranuclear palsy 1.100 2.7e-02

Protein-protein Interaction (1)

Gene RIF (98)

AA Sequence

MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAENDYIN      1 - 70
ASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKESVKCAQYWPTDDQEMLFKETG     71 - 140
FSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPDHG    141 - 210
PAVIHCSAGIGRSGTFSLVDTCLVLMEKGDDINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIK    211 - 280
GDSSIQKRWKELSKEDLSPAFDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALR    281 - 350
KRIREDRKATTAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL         351 - 415
//

Text Mined References (152)

PMID Year Title