Property Summary

NCBI Gene PubMed Count 132
PubMed Score 269.50
PubTator Score 169.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
ependymoma 1.200 0.014
osteosarcoma 2.635 0.000
glioblastoma 1.400 0.000
non-small cell lung cancer -1.070 0.000
group 3 medulloblastoma 1.300 0.006
Alzheimer's disease 1.100 0.026
Pick disease 1.700 0.000
progressive supranuclear palsy 1.100 0.027
ovarian cancer -1.900 0.000

Synonym

Accession P17706 A8K955 A8MXU3 K7ENG3 Q96AU5 Q96HR2
Symbols PTN2
PTPT
TCPTP
TC-PTP
TCELLPTP

Gene

PDB

1L8K  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (89)

PMID Text
26734582 role of PTPN2 in type 1 diabetes and Crohn's disease (review)
26344020 rs2542151 SNP in The PTPN2 gene is associated with T1DM in Chinese Han children
26208487 Loss of protein tyrosine phosphatase, non-receptor type 2 is associated with activation of AKT and tamoxifen resistance in breast cancer.
26139109 PTPN2 is linked to the pathogenesis of rheumatoid arthritis via synovial fibroblasts. It is a regulator of lnterleukin-6 production in rheumatoid arthritis synovial fibroblasts.
26090670 Angiopoietin-1 Regulates Brain Endothelial Permeability through PTPN-2 Mediated Tyrosine Dephosphorylation of Occludin
26026268 demonstrate that SIPAR directly interacts with T cell protein tyrosine phosphatase TC45 and enhances its association with STAT3
25492475 dysfunction of PTPN2 results in aberrant T-cell differentiation and intestinal dysbiosis similar to those observed in human CD. Our findings indicate a novel and crucial role for PTPN2 in chronic intestinal inflammation.
25489960 Single-nucleotide polymorphism in PTPN2 gene is associated with Crohn's disease.
25460303 PTPN2 and genes of the vitamin D pathway may have roles in risk of juvenile idiopathic arthritis
25311528 FGFR3 regulation by PTPN1 and PTPN2 depend on FGFR3 localization and A-loop sequence.
More...

AA Sequence

MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAENDYIN      1 - 70
ASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKESVKCAQYWPTDDQEMLFKETG     71 - 140
FSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPDHG    141 - 210
PAVIHCSAGIGRSGTFSLVDTCLVLMEKGDDINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIK    211 - 280
GDSSIQKRWKELSKEDLSPAFDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALR    281 - 350
KRIREDRKATTAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL         351 - 415
//

Text Mined References (143)

PMID Year Title
26734582 2015 Genetic Variations of PTPN2 and PTPN22: Role in the Pathogenesis of Type 1 Diabetes and Crohn's Disease.
26344020 2015 Genetic Variants of PTPN2 Gene in Chinese Children with Type 1 Diabetes Mellitus.
26208487 2015 Loss of protein tyrosine phosphatase, non-receptor type 2 is associated with activation of AKT and tamoxifen resistance in breast cancer.
26139109 2015 Protein tyrosine phosphatase nonreceptor type 2: an important regulator of lnterleukin-6 production in rheumatoid arthritis synovial fibroblasts.
26090670 2015 Angiopoietin-1 Regulates Brain Endothelial Permeability through PTPN-2 Mediated Tyrosine Dephosphorylation of Occludin.
26026268 2015 Nuclear termination of STAT3 signaling through SIPAR (STAT3-Interacting Protein As a Repressor)-dependent recruitment of T cell tyrosine phosphatase TC-PTP.
25492475 2015 PTPN2 controls differentiation of CD4? T cells and limits intestinal inflammation and intestinal dysbiosis.
25489960 2015 Immunochip analysis identification of 6 additional susceptibility loci for Crohn's disease in Koreans.
25460303 2015 Epistasis amongst PTPN2 and genes of the vitamin D pathway contributes to risk of juvenile idiopathic arthritis.
25311528 2015 Differential regulation of FGFR3 by PTPN1 and PTPN2.
More...