Property Summary

NCBI Gene PubMed Count 16
PubMed Score 5.46
PubTator Score 8.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 1563 5.5e-07
psoriasis 6685 6.4e-05
osteosarcoma 7933 6.0e-04
breast carcinoma 1614 1.5e-03
non primary Sjogren syndrome sicca 840 2.7e-02
Disease Target Count Z-score Confidence
Pyoderma gangrenosum 9 3.11 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.600 6.4e-05
osteosarcoma -1.272 6.0e-04
tuberculosis 1.500 5.5e-07
breast carcinoma 1.200 1.5e-03
non primary Sjogren syndrome sicca 1.300 2.7e-02

Gene RIF (3)

PMID Text
25081058 PTPN18 regulates HER2-mediated cellular functions through defining both its phosphorylation and ubiquitination barcodes.
16303740 novel isoform of PTPN18 based on analysis of expressed sequence tags was discovered; deletion of 4 exons in the catalytic domain of the isoform may alter enzymatic activity; 2 of the novel isoform predictions were experimentally validated through RT-PCR
14660651 BDP1 has a role in negative regulation of HER2 signaling

AA Sequence

MSRSLDSARSFLERLEARGGREGAVLAGEFSDIQACSAAWKADGVCSTVAGSRPENVRKNRYKDVLPYDQ      1 - 70
TRVILSLLQEEGHSDYINGNFIRGVDGSLAYIATQGPLPHTLLDFWRLVWEFGVKVILMACREIENGRKR     71 - 140
CERYWAQEQEPLQTGLFCITLIKEKWLNEDIMLRTLKVTFQKESRSVYQLQYMSWPDRGVPSSPDHMLAM    141 - 210
VEEARRLQGSGPEPLCVHCSAGCGRTGVLCTVDYVRQLLLTQMIPPDFSLFDVVLKMRKQRPAAVQTEEQ    211 - 280
YRFLYHTVAQMFCSTLQNASPHYQNIKENCAPLYDDALFLRTPQALLAIPRPPGGVLRSISVPGSPGHAM    281 - 350
ADTYAVVQKRGAPAGAGSGTQTGTGTGTGARSAEEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSP    351 - 420
AGSGAYEDVAGGAQTGGLGFNLRIGRPKGPRDPPAEWTRV                                  421 - 460
//

Text Mined References (21)

PMID Year Title
25081058 2014 The catalytic region and PEST domain of PTPN18 distinctly regulate the HER2 phosphorylation and ubiquitination barcodes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19167335 2009 Large-scale structural analysis of the classical human protein tyrosine phosphatome.
16341674 2005 Transcriptome analysis of human gastric cancer.
16303740 2005 A bioinformatics analysis of protein tyrosine phosphatases in humans.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15588985 2005 Substrate-trapping techniques in the identification of cellular PTP targets.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660651 2004 Negative regulation of HER2 signaling by the PEST-type protein-tyrosine phosphatase BDP1.
12554790 2003 Protein tyrosine phosphatase PTP20 induces actin cytoskeleton reorganization by dephosphorylating p190 RhoGAP in rat ovarian granulosa cells stimulated with follicle-stimulating hormone.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11971877 2002 Mutations in CD2BP1 disrupt binding to PTP PEST and are responsible for PAPA syndrome, an autoinflammatory disorder.
11163214 2000 Cytoskeletal protein PSTPIP1 directs the PEST-type protein tyrosine phosphatase to the c-Abl kinase to mediate Abl dephosphorylation.
11158295 2001 SH2 domain-mediated interaction of inhibitory protein tyrosine kinase Csk with protein tyrosine phosphatase-HSCF.
9804817 1998 PSTPIP 2, a second tyrosine phosphorylated, cytoskeletal-associated protein that binds a PEST-type protein-tyrosine phosphatase.
9422760 1998 Identification of a novel polyproline recognition site in the cytoskeletal associated protein, proline serine threonine phosphatase interacting protein.
9265651 1997 PSTPIP: a tyrosine phosphorylated cleavage furrow-associated protein that is a substrate for a PEST tyrosine phosphatase.
8950995 1996 Characterization of the PEST family protein tyrosine phosphatase BDP1.