Property Summary

NCBI Gene PubMed Count 537
PubMed Score 1308.80
PubTator Score 958.99

Knowledge Summary


No data available


  Disease Sources (7)

Disease Target Count P-value
lung adenocarcinoma 2714 3.46568382145693E-17
osteosarcoma 7933 6.97203179321468E-8
breast carcinoma 1614 8.32021905637698E-5
oligodendroglioma 2849 3.80168832092699E-4
medulloblastoma, large-cell 6234 8.82309487668874E-4
Pick disease 1893 0.00113802412310452
ependymoma 2514 0.00177385416171052
adult high grade glioma 2148 0.00331055117333534
progressive supranuclear palsy 674 0.00367222568265501
Down syndrome 548 0.00451682912104919
hereditary spastic paraplegia 313 0.00494600400193201
dermatomyositis 967 0.0059079800413174
astrocytic glioma 2241 0.0064397037886553
Gaucher disease type 1 171 0.013370080399036
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0204367225461519
Multiple myeloma 1328 0.0246277528787756
glioblastoma 5572 0.0292582223719261
group 4 medulloblastoma 1875 0.0487576401199113
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Immune system cancer 38 0.0 2.0
Lymphoid leukemia 69 0.0 1.0
Disease Target Count Z-score Confidence
Celiac disease 112 0.0 2.0
Hemolytic anemia 70 0.0 2.0
Disease Target Count
Leukemia, juvenile myelomonocytic 7


  Differential Expression (18)

Disease log2 FC p
Multiple myeloma 1.196 0.025
astrocytic glioma 1.400 0.006
ependymoma 1.500 0.002
oligodendroglioma 1.800 0.000
osteosarcoma 2.945 0.000
glioblastoma 1.200 0.029
medulloblastoma, large-cell 1.300 0.001
hereditary spastic paraplegia -1.204 0.005
pancreatic ductal adenocarcinoma liver m... -1.691 0.020
breast carcinoma -1.100 0.000
adult high grade glioma -1.500 0.003
group 4 medulloblastoma 1.300 0.049
lung adenocarcinoma -1.500 0.000
Pick disease -1.100 0.001
progressive supranuclear palsy -1.400 0.004
Gaucher disease type 1 -1.300 0.013
Down syndrome 1.400 0.005
dermatomyositis -1.100 0.006


Accession Q06124 A8K1D9 Q96HD7
Symbols CFC



4QSY   4JE4   4JEG   2SHP   3B7O   3MOW   3O5X   3TKZ   3TL0   3ZM0   3ZM1   3ZM2   3ZM3   4DGP   4DGX   4GWF   4H1O   4H34   4JMG   4NWF   4NWG   4OHD   4OHE   4OHH   4OHI   4OHL   4PVG   4RDD   5DF6   5EHP   5EHR   5I6V   5IBM   5IBS  

  Ortholog (10)

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
602367 confirmatory 160 / 0 / 6 Dose Response selectivity of inhibitors of Striatal-Enriched Phosphatase (STEP) in a SHP2 (PTPN11) Inhibition Assay

Gene RIF (357)

27030275 Combined X-ray crystallography, small-angle X-ray scattering, and biochemistry to elucidate structural and mechanistic features of three cancer-associated SHP2 variants with single point mutations within the N-SH2:PTP interdomain autoinhibitory interface.
26755576 find that Shp2 is distributed to the kinetochore, centrosome, spindle midzone, and midbody
26742426 We found that LS-associated SHP2 mutants (Y279C, T468M, Q506P, and Q510E) exhibited a substantially reduced phosphatase activity toward parafibromin when compared with wild-type SHP2.
26728598 The existence of a tight association between SHP2 and EGFR expression in tumors and cell lines further suggested the importance of SHP2 in EGFR expression.
26617336 SHP2 preferentially binds to and dephosphorylates Ras to increase its association with Raf and activate downstream proliferative Ras/ERK/MAPK signaling.
26556238 SHP-2 co-localized with the Cryptosporidium parvum sporozoite and this interaction increased the rate of C. parvum infectivity through SH2-mediated SHP-2 activity in intestinal epithelial cells.
26385178 a decrease in PTEN facilitates ROS/SHP2 signaling, causing lung cancer cells to become unresponsive to IFN-gamma
26365186 PTPN11 is a central node in intrinsic and acquired resistance to targeted cancer drugs.
26315028 protein tyrosine phosphatase non-receptor type 1 and type 2 are potential therapeutic targets for breast cancer stem cells and gamma-T3 is a promising natural drug for future breast cancer therapy.
26286251 mutation in PTPN11 is associated with co-occurrence of hypertrophic cardiomyopathy and myeloproliferative disorder in a neonate with Noonan syndrome.

AA Sequence

QSPLPPCTPTPPCAEMREDSARVYENVGLMQQQKSFR                                     561 - 597

Text Mined References (556)

PMID Year Title
27030275 2016 Structural and Functional Consequences of Three Cancer-Associated Mutations of the Oncogenic Phosphatase SHP2.
26755576 2016 Gain-of-function mutations of Ptpn11 (Shp2) cause aberrant mitosis and increase susceptibility to DNA damage-induced malignancies.
26742426 2016 Determination of the catalytic activity of LEOPARD syndrome-associated SHP2 mutants toward parafibromin, a bona fide SHP2 substrate involved in Wnt signaling.
26728598 2016 SHP2 acts both upstream and downstream of multiple receptor tyrosine kinases to promote basal-like and triple-negative breast cancer.
26617336 2015 Inhibition of SHP2-mediated dephosphorylation of Ras suppresses oncogenesis.
26556238 2015 SHP-2 Mediates Cryptosporidium parvum Infectivity in Human Intestinal Epithelial Cells.
26385178 2015 Loss of PTEN causes SHP2 activation, making lung cancer cells unresponsive to IFN-?.
26365186 2015 PTPN11 Is a Central Node in Intrinsic and Acquired Resistance to Targeted Cancer Drugs.
26315028 2015 Gamma tocotrienol targets tyrosine phosphatase SHP2 in mammospheres resulting in cell death through RAS/ERK pathway.
26286251 2015 Co-occurrence of hypertrophic cardiomyopathy and myeloproliferative disorder in a neonate with Noonan syndrome carrying Thr73Ile mutation in PTPN11.