Property Summary

NCBI Gene PubMed Count 122
PubMed Score 29.64
PubTator Score 198.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 4.200 2.3e-08
psoriasis -1.800 1.4e-04
ependymoma 1.200 2.5e-03
glioblastoma 1.300 1.0e-04
group 3 medulloblastoma 2.300 2.6e-05
periodontitis 1.600 1.8e-24
adrenocortical carcinoma 1.294 9.2e-04
intraductal papillary-mucinous adenoma (... -1.700 1.2e-05
intraductal papillary-mucinous carcinoma... -1.300 5.3e-04
intraductal papillary-mucinous neoplasm ... -1.200 7.1e-03
interstitial cystitis 2.200 7.8e-05
pediatric high grade glioma 1.200 9.2e-04
pilocytic astrocytoma 2.000 7.2e-08
ulcerative colitis 1.300 6.8e-03
ovarian cancer 1.500 8.3e-04

Gene RIF (111)

PMID Text
27096756 Promotes uveal melanoma aggressiveness via membrane accumulation of matrix metalloproteinase 14 (MMP14)
26975394 PRL-3 has a role in the pathogenesis of prostate cancer.
26669864 Examination of clinical samples confirmed that USP4 expression positively correlates with PRL-3 protein expression, but not mRNA transcript levels.
26597054 PRL-3 provides a strategic survival advantage to tumour cells via its effects on mTOR.
26563151 Our findings suggested that PRL-3 genomic gain may represent an aggressive phenotype of primary colorectal cancer
26070892 PTP4A3 over expression independently predicted the metastasis and outcome of upper tract urothelial carcinoma, which was even more important in organ confined disease.
25687758 Data inticate that heat shock protein 60 (HSP60) interacted constitutively with NKG2D ligand ULBP2 and phosphatase of regenerating liver 3 (PRL-3) regulated HSP60 tyrosine phosphorylation.
25475733 miR-495 methylation-associated silencing inhibits the migration and invasion of human gastric cancer cells by directly targeting PRL-3
25139404 STAT3 binds to the -201 to -210 region of PRL-3. STAT3 functionally regulates PRL-3. STAT3 core signature was enriched in AML with high PRL-3 expression. The STAT3/PRL-3 regulatory loop contributes to the pathogenesis of AML.
25136802 These studies reveal a critical role of autophagy in PTP4A3-driven cancer progression.
24885636 Tumor-associated macrophages participate in the metastasis of CRC induced by PRL-3 through secretion of IL-6 and IL-8 in a KCNN4 dependent manner.
24737397 Aberrant PRL-3 expression promoted cell cycle progression and enhanced the antiapoptotic machinery of AML cells to drug cytotoxicity through downregulation of p21 and upregulation of Cyclin D1 and CDK2 and activation of STAT5 and AKT.
24696260 The expression of PRL-3, but not of E-cadherin, was associated with shorter survival of patients. PRL-3 and E-cadherin exhibit interactions in gastric cancer and are involved in the formation of lymph node metastases
24686170 PRL-3 and Leo1 levels were positively associated in AML patient samples.
24403062 These findings strongly support a role for PTP4A3 as an important contributor to endothelial cell function and as a multimodal target for cancer therapy and mitigating VEGF-regulated angiogenesis.
24204707 Studies indicate a significant association of phosphatase of regenerating liver 3 (PRL-3) overexpression with overall survival and some clinicopathological features in gastric cancer.
24030100 PRL3 provokes a tyrosine phosphoproteome to drive prometastatic signal transduction.
23989302 PRL-3 induces microvascular vessel formation by facilitating VEGF expression in endometrial adenocarcinoma tissues
23929599 Clinically, high PRL-3 mRNA expression was associated with FLT3-ITD mutations in four independent acute myeloid leukaemia datasets with 1158 patients.
23867504 PRL-3-induced hyperactivation of EGFR correlates with increased cell growth, promigratory characteristics, and tumorigenicity in colorectal cancer.
23729584 The strong expression of PRL-3 in the primary tumor that was significantly correlated with the grade and clinical stage suggest that PTP4A3 participates in the process of endometrial carcinogenesis.
23691193 PRL-3 is phosphorylated downstream of Src, and this phosphorylation is required for PRL-3 to promote invasion, motility and activation of RhoC in cell culture systems.
23572150 Explored the mechanism by which PRL-3 mediates EMT. Demonstrated that PRL-3 induced the expression of KCNN4 channels, leading to EMT and the down-regulation of E-cadherin.
23462371 The ability of DHEA to target prenylation pathway could be utilized to inhibit PRL-3 prenylation for successful prevention of CRC metastases.
23418787 PRL-3 plays a critical role in ovarian cancer tumorigenicity and maintaining the malignant phenotype. PRL-3 may inhibit c-fos transcriptional regulation of integrin alpha2 signaling.
23364316 our findings demonstrate that PRL-3-targeted DNA vaccine can generate significantly preventive and therapeutic effects on the growth of breast cancer expressing PRL-3 through the induction of cellular immune responses to PRL-3
23362275 Results suggest that TRP32 maintains the reduced state of PRL and thus regulates the biological function of PRL.
23178297 these results demonstrate PRL-3 as a novel regulator of NF-kappaB signaling pathway through RAP1.
23092334 A direct interaction between PRL-3 and integrin beta1 and characterized Y783 of integrin beta1 as a bona fide substrate of PRL-3, which is negatively regulated by integrin alpha1.
23036709 results come to their conclusion that PTP4A3 plays an important role in the growth of lung cancer cells. PTP4A3 may be considered as a valuable target for anti-tumor therapeutic strategies
22995644 These data support a role for PRL-3 in BCR-ABL signalling and CML biology and may be a potential therapeutic target downstream of BCR-ABL in TKI resistant mutant cells.
22855168 PRL-3 expression was related to LVI or necrosis which is important for tumor invasiveness, we could not find that PRL-3 as an important prognostic factor in breast cancer patient
22825514 Data indicate that downregulating PRL-3 inhibit cell migration and invasion by inactivating RhoA to downregulate mDia1 to reorganizate cytoskeleton of lung cancer cells.
22677902 The overexpression of PRL-3 in colon cancer cells induced the expression of miR-21, miR-17 and miR-19a by activating STAT3.
22595524 Data identify a new function for PRL-3 and show that Arf1 is a new PRL-3-dependent mediator of enhanced migration of cancer cells through enhanced recycling of matrix receptors.
22469786 our findings suggest that miR-495 and miR-551a both act as tumor suppressors by targeting the PRL-3 oncogene and inhibiting gastric cancer cell migration and invasion.
22440248 High expression of the PRL-3 gene might be a useful predictor of poor postoperative outcome in patients with colorectal cancer.
22413991 Studies indicate that PRL-1 and PRL-2 and PRL-3 are oncogenes and belong to the few phosphatases that lead to the development of cancer.
22345654 PRL-3 is a key regulator of histone demethylation. JMJD1B seems to be a candidate tumour suppressor and JMJD2B seems to be a potential oncoprotein in the development and progression of CRC.
22340241 Results imply that TCTP might be a mediator of PRL-3-promoted proliferation, migration and invasion of human colon cancer cells.
22331511 PRL-3 gene expression, may have prognostic significance in gastric cancer, treated with radical gastrectomy.
22261620 Study of colon cancer patients with combined SNCG/Hiwi/PRL-3/ARD1 finds hazard ratios to poor outcome.
22137788 emodin is a PRL-3 inhibitor and a good lead molecule for obtaining a selective PRL-3 inhibitor
22131018 It was found that PRL-3 induced MMP-7 through oncogenic pathways including PI3K/AKT and ERK and that there is a relationship between the expression of PRL-3 and MMP-7 in human tumor cell lines.
22073279 suggest that PRL-3 functions downstream of the VEGF/MEF2C pathway in endothelial cells and may play an important role in tumor angiogenesis
22028901 role of PTP4A3 in acute myeloid leukemia
21914394 Downregulation of the PRL-3 gene can decrease the migratory capacity of endometriotic stromal cells.
21806020 A Cys104Ser variant is shown to be not only catalytically inactive but also structurally destabilized and unable to promote cell migration, whereas wild-type PRL-3 promotes cell migration of stable HEK293 cell lines
21790231 PRL-3 but not PRL-1 or PRL-2 expressions were significantly higher in OSCC and dysplasia than in normal mucosa tissues.
21725609 PRL-3 promoted the proliferation of LoVo cells through upregulation of KCNN4 channels which facilitated the G2/M transition.
21589872 PRL-3 plays a potential pathological role in AML and it might be a useful therapeutic target in AML, and warrant clinical investigation
21478108 a statistically significant correlation between local lymph node involvement and positive expression of PTP4A3 in the primary tumour (p=0.0000). study seems to prove that PTP4A3 may have a significant impact on the lymphatic spread of gastric carcinoma
21466710 upregulated expression in advanced gastric cancer due to genomic amplification
21320469 These results demonstrate that FKBP38 is a novel regulator of the oncogenic protein PRL-3 abundance and that alteration in the stability of PRL-3 can have a dramatic impact on cell proliferation.
21291404 REVIEW: role of this protein in the process of cancer angiogenesis and metastasis, and poor prognosis
21159255 The migration of A549 cell decreased after blockage of PRL-3 and RhoC. PRL-3, RhoC could increase cell migration in A549 cells.
21135111 PTP4A3 overexpression in uveal melanoma cell lines significantly increased cell migration and invasiveness in vivo, suggesting a direct role for this protein in metastasis.
21084277 findings suggest that inhibiting PRL-3 expression might be an important mechanism through which TGFbeta suppresses metastasis in colon cancer
20860603 found that phosphatase of regenerating liver-3 phosphatase activity was associated with the suppression of the phospho-nucleolar-specific protein nucleolin (NCL) levels and nucleolar assembly of NCL protein
20806969 Data show that stathmin plays a key role in CRC as a new target of PRL-3. Interaction between PRL-3 and stathmin leads to MT destabilization of CRC cells, which contributes to progression and metastasis of CRC.
20609352 Overexpression of PRL-3 is associated with cancer.
20516731 Findings suggest that PRL-3 expression may contribute to the establishment of liver metastasis and to the growth of primary foci of human gastric cancer.
20364335 PRL-3 may be involved in carcinogenesis of cervix and lymph node metastases of squamous cell carcinoma of the cervix
20140626 These results suggest that PRL-3 expression can indicate the potential role of LNM to some extent. Increasing the risk of tumor metastasis. The results imply that PRL-3 might be a novel molecular marker for predicting relapse of invasive breast cancer.
20045518 Expression of PRL-3 is related to the clinical stages and recurrence of endometriosis, which provides use with a novel marker and promising target in the treatment of human endometriosis.
19945467 PRL-3, like PRL-1, can negatively regulate p53 via the activation of PIRH2 and MDM2 in cancer cells.
19930715 results suggest that PRL-3's roles in motility, invasion, and metastasis in colon cancer are critically controlled by the integrin beta1-ERK1/2-MMP2 signaling
19846928 PTP4A3 is strongly expressed in colorectal carcinoma metastases of the lymph nodes although the significance of this is unclear.
19757198 our results suggested high expression of PRL-3 was correlated with progression and metastasis of primary intrahepatic cholangiocarcinoma and indicated negative prognostic impact
19586538 Demonstrate that products secreted by carcinoma-associated fibroblasts (CAFs) trigger PRL-3 overexpression in cancer cells.
19440036 PRL-3 promoted downregulation of CDH22 expression. PRL-3 promoted upregulation of mesenchymal marker vimentin & downregulation of epithelial markers E-cadherin & cytokeratin. Glycogen synthase kinase-3beta inactivation by PRL-3 was a key event in EMT.
19424625 Propose that PRL-3 expression can have a clinical potential as a prognostic biomarker that may facilitate the development of adjuvant chemotherapy for advanced gastric cancer with stage I disease.
19322925 PRL-3 expression is a new independent prognostic indicator to predict the potential of recurrence and survival in patients with gastric cancer at the time of tumor resection
19236507 PRL-3 overexpression in early stages of colonic cancer
19214221 These results suggest that cellular localization of PRL-3 is highly correlated with its function in tumor metastasis.
19187591 Knockdown of PRL-3 significantly suppressed the proliferation of SGC7901 cells in vitro and tumor growth in vivo. PRL-3 plays a key role in the growth of gastric cancer.
19152186 PRL-3 induces microvascular and lymphatic vessel formation by facilitating VEGF and VEGF-C expression in lung cancer tissues and up-regulates pERK and Rho expression and activity
19132388 PRL-3 expression is associated with gastric cancer progression
19115206 PRL-3 may play an important role for the promotion of CRC cell migration and metastatic potential through direct KRT8 dephosphorylation
19101992 phosphatase of regenerating liver-3 has a role in tumor progression in nasopharyngeal carcinoma
19087692 High PRL-3 expression is associated with gastric cancer progression.
19040419 analysis of the molecular determinants of PRL-3
19009246 High expression of PRL-3 can promote growth of gastric cancer.
19002188 PRL-3 overexpression is a common event in stage III colorectal primary tumours that is further selected during liver dissemination. PRL-3 expression correlates with tumour aggressiveness and is a promising predictor of distant metastases.
18813812 liver metastasis by PRL-3 is putatively mediated through lymph node metastasis and elevated tumor markers in the serum and the PRL-3 expression may not represent a direct causative mechanism of liver metastasis.
18803057 PRL-3 expression was closely associated with colorectal carcinoma tumor stage and lymph node metastasis, but no relationship with age, sex, tumor size, degree of differentiation.
18684031 PRL-1 and PRL-3 mRNAs may be involved in and used to predict the metastasis of esophageal squamous cell carcinoma. Possibility of using PRL-1 and PRL-3 as therapeutical target.
18636172 Data show that PRL-3 is up-regulated in tumor tissue compared with corresponding noncancerous liver tissue, and suggest that PRL-3 plays a key role in the angiogenesis and invasion of hepatocellular carcinoma.
18561324 high expression of PRL-3 in the lymph node metastasis (LNM) of gastric cancer had a negative impact on the prognosis of the patients, and plays important roles in LNM of gastric cancer and the tumor growth
18268019 PRL3 has a role in the gene-specific translational control of Csk expression
18078820 The identification of Ezrin as a specific and direct cellular substrate of PRL-3, is reported.
18021371 This is the first report of detecting PRL-3 expression in gliomas, especially in grades III and IV.
17934070 PRL-3 is a gene product specifically expressed in malignant plasma cells and may have a role in migration of these cells.
17717498 down-regulation of the PRL-3 gene is important in lung cancer metastasis and provide a new hypothesis of lung cancer metastases
17545077 Data show that the entire coding region of PRL-3 gene was cloned, and the recombinant vector was successfully constructed and expressed, which may provide the basis for further study of the relationship between colorectal carcinoma and PRL-3 gene.
17545014 Snail regulates the activity of PRL-3 gene by binding to the promoter of PRL-3 gene in SW480 cells.
17440740 Colonic adenocarcinoma cells have the ability to produce PTP4A1, PTP4a2, and PTP4A3, which may relate to the lymph node metastasis of colonic adenocarcinoma.
17235563 PRL-3 expression may participate in the progression and metastasis of gastric carcinoma and might be a novel molecular marker for aggressive gastric cancer.
17018620 Injection of PRL-3-expressing CHO cells into nude mice to form local tumors resulted in the recruitment of host endothelial cells into the tumors and initiation of angiogenesis. PRL-3-expressing cells reduced IL-4 expression levels.
16873432 results suggest that PRL-3 may serve as an unfavorable prognostic marker in breast cancer, especially for patients with node-negative diseases
16832410 PRL-3 mRNA expression was significantly higher in malignant compared to benign breast tissue. The results suggest that PRL-3 might serve as a novel prognostic factor in breast cancer, which may help to predict an adverse disease outcome.
16505094 In tumor cells, PRL-3 mRNA levels varied markedly with high expression in SKNAS neuroblastoma, MCF-7 and BT474 breast carcinoma, Hep3B hepatocellular carcinoma, and HCT116 colon carcinoma.
16472776 identified integrin alpha1 as a PRL-3-interacting protein for the first time, and verified this physical association with pull-down and co-immunoprecipitation assays
16203771 PRL-3 phosphatase has a role in ovarian cancer growth
15788667 Elevated PRL-3 protein expression is associated with colorectal cancer metastasis
15534108 PRL-3 expression in colorectal cancers may contribute to the establishment of liver metastasis
15161639 PRL-3 expression was up-regulated in human liver carcinoma compared with normal liver
15135076 human PRL-3 structure by NMR
14704153 presentation of the solution structure of PRL-3, the first structure of a PRL phosphatase. The structure places PRL phosphatases in the class of dual specificity phosphatases with closest structural homology to the VHR phosphatase
14654542 PRL-3 is expressed in tumor metastasis and vasculature, regardless of the tumor source.
11598267 Data suggest that the PRL-3 gene is important for colorectal cancer metastasis and provide a new therapeutic target for these intractable lesions.

AA Sequence

MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPF      1 - 70
DDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGA     71 - 140
INSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM                                         141 - 173
//

Text Mined References (122)

PMID Year Title
27096756 2016 Protein Tyrosine Phosphatase 4A3 (PTP4A3) Promotes Human Uveal Melanoma Aggressiveness Through Membrane Accumulation of Matrix Metalloproteinase 14 (MMP14).
26975394 2016 Phosphatase of regenerating liver 3 (PRL-3) is overexpressed in human prostate cancer tissue and promotes growth and migration.
26669864 2016 Ubiquitin-Specific Protease 4-Mediated Deubiquitination and Stabilization of PRL-3 Is Required for Potentiating Colorectal Oncogenesis.
26597054 2015 PRL-3 activates mTORC1 in Cancer Progression.
26563151 2016 Genomic gain of the PRL-3 gene may represent poor prognosis of primary colorectal cancer, and associate with liver metastasis.
26070892 2015 PTP4A3 Independently Predicts Metastasis and Survival in Upper Tract Urothelial Carcinoma Treated with Radical Nephroureterectomy.
25687758 2015 PRL-3 mediates the protein maturation of ULBP2 by regulating the tyrosine phosphorylation of HSP60.
25475733 2015 Methylation-associated silencing of miR-495 inhibit the migration and invasion of human gastric cancer cells by directly targeting PRL-3.
25139404 2014 Phosphatase of regenerating liver-3 is regulated by signal transducer and activator of transcription 3 in acute myeloid leukemia.
25136802 2014 A role of autophagy in PTP4A3-driven cancer progression.
24885636 2014 Tumor-associated macrophage-derived IL-6 and IL-8 enhance invasive activity of LoVo cells induced by PRL-3 in a KCNN4 channel-dependent manner.
24737397 2014 Independent oncogenic and therapeutic significance of phosphatase PRL-3 in FLT3-ITD-negative acute myeloid leukemia.
24696260 2014 PRL-3 and E-cadherin show mutual interactions and participate in lymph node metastasis formation in gastric cancer.
24686170 2014 LEO1 is regulated by PRL-3 and mediates its oncogenic properties in acute myelogenous leukemia.
24403062 2014 Protein-tyrosine phosphatase 4A3 (PTP4A3) promotes vascular endothelial growth factor signaling and enables endothelial cell motility.
24204707 2013 Poor prognosis of phosphatase of regenerating liver 3 expression in gastric cancer: a meta-analysis.
24030100 2013 Phosphatase of regenerating liver 3 (PRL3) provokes a tyrosine phosphoproteome to drive prometastatic signal transduction.
23989302 2014 Phosphatase of regenerating liver-3 induces angiogenesis by increasing extracellular signal-regulated kinase phosphorylation in endometrial adenocarcinoma.
23929599 2013 Oncogenic roles of PRL-3 in FLT3-ITD induced acute myeloid leukaemia.
23867504 2013 Metastasis-associated PRL-3 induces EGFR activation and addiction in cancer cells.
23729584 2013 Expression of phosphatase of regenerating liver-3 (PRL-3) in endometrioid cancer and lymph nodes metastases.
23691193 2013 Src-mediated phosphorylation of the tyrosine phosphatase PRL-3 is required for PRL-3 promotion of Rho activation, motility and invasion.
23572150 2013 KCNN4 channels participate in the EMT induced by PRL-3 in colorectal cancer.
23462371 2013 Can dehydroepiandrostenedione (DHEA) target PRL-3 to prevent colon cancer metastasis?
23418787 2013 PRL-3 suppresses c-Fos and integrin ?2 expression in ovarian cancer cells.
23364316 2013 Suppression of breast tumor growth by DNA vaccination against phosphatase of regenerating liver 3.
23362275 2013 Thioredoxin-related protein 32 (TRP32) specifically reduces oxidized phosphatase of regenerating liver (PRL).
23178297 2013 PRL-3 activates NF-?B signaling pathway by interacting with RAP1.
23092334 2012 Phosphatase of regenerating liver-3 directly interacts with integrin ?1 and regulates its phosphorylation at tyrosine 783.
23036709 2012 Effect of protein-tyrosine phosphatase 4A3 by small interfering RNA on the proliferation of lung cancer.
22995644 2012 The pro-metastasis tyrosine phosphatase, PRL-3 (PTP4A3), is a novel mediator of oncogenic function of BCR-ABL in human chronic myeloid leukemia.
22855168 2012 Clinical importance of phosphatase of regenerating liver-3 expression in breast cancer.
22825514 Downregulating PRL-3 inhibit migration and invasion of lung cancer cell via RhoA and mDia1.
22677902 2012 miR-21, miR-17 and miR-19a induced by phosphatase of regenerating liver-3 promote the proliferation and metastasis of colon cancer.
22595524 2012 The phosphatase of regenerating liver 3 (PRL-3) promotes cell migration through Arf-activity-dependent stimulation of integrin ?5 recycling.
22469786 2012 miR-495 and miR-551a inhibit the migration and invasion of human gastric cancer cells by directly interacting with PRL-3.
22440248 2012 The expression of the phosphatase regenerating liver 3 gene is associated with outcome in patients with colorectal cancer.
22413991 2013 Molecular mechanisms of the PRL phosphatases.
22345654 2013 An epigenetic role for PRL-3 as a regulator of H3K9 methylation in colorectal cancer.
22340241 2011 Proteomic analysis identifies translationally controlled tumor protein as a mediator of phosphatase of regenerating liver-3-promoted proliferation, migration and invasion in human colon cancer cells.
22331511 2012 Prognostic significance of high phosphatase of regenerating liver-3 expression in patients with gastric cancer who underwent curative gastrectomy.
22261620 2012 Combined phenotype of 4 markers improves prognostic value of patients with colon cancer.
22137788 2012 Emodin inhibits migration and invasion of DLD-1 (PRL-3) cells via inhibition of PRL-3 phosphatase activity.
22131018 2012 Phosphatase of regenerating liver-3 promotes migration and invasion by upregulating matrix metalloproteinases-7 in human colorectal cancer cells.
22073279 2011 VEGF promotes the transcription of the human PRL-3 gene in HUVEC through transcription factor MEF2C.
22028901 2011 Retroviral integration mutagenesis in mice and comparative analysis in human AML identify reduced PTP4A3 expression as a prognostic indicator.
21914394 2011 [Effects of PRL-3 siRNA on the migration of endometriotic stromal cells].
21806020 2011 The metastasis-promoting phosphatase PRL-3 shows activity toward phosphoinositides.
21790231 2011 Increased expression of the PRL-3 gene in human oral squamous cell carcinoma and dysplasia tissues.
21725609 2011 PRL-3 promotes the proliferation of LoVo cells via the upregulation of KCNN4 channels.
21589872 2011 PRL-3, a metastasis associated tyrosine phosphatase, is involved in FLT3-ITD signaling and implicated in anti-AML therapy.
21478108 2010 PTP4A3 (PRL-3) expression correlate with lymphatic metastases in gastric cancer.
21466710 2011 Therapeutic potential of PRL-3 targeting and clinical significance of PRL-3 genomic amplification in gastric cancer.
21320469 2011 The essential role of FKBP38 in regulating phosphatase of regenerating liver 3 (PRL-3) protein stability.
21291404 2011 PRL-3, an emerging marker of carcinogenesis, is strongly associated with poor prognosis.
21159255 2010 [Expressions and significances of PRL-3 and RhoC in A549 cell].
21135111 2011 High PTP4A3 phosphatase expression correlates with metastatic risk in uveal melanoma patients.
21084277 2011 Phosphatase PRL-3 is a direct regulatory target of TGFbeta in colon cancer metastasis.
20860603 2010 Requirement of phosphatase of regenerating liver-3 for the nucleolar localization of nucleolin during the progression of colorectal carcinoma.
20806969 2010 Stathmin, a new target of PRL-3 identified by proteomic methods, plays a key role in progression and metastasis of colorectal cancer.
20609352 2010 PCBP1 suppresses the translation of metastasis-associated PRL-3 phosphatase.
20516731 2010 Constitutive suppression of PRL-3 inhibits invasion and proliferation of gastric cancer cell in vitro and in vivo.
20364335 2011 Expression of phosphatase of regenerating liver-3 in squamous cell carcinoma of the cervix.
20140626 2010 Prognostic and metastatic value of phosphatase of regenerating liver-3 in invasive breast cancer.
20045518 2010 Phosphatase of regenerating liver-3: a novel and promising marker in human endometriosis.
19945467 2010 Downregulation of p53 by phosphatase of regenerating liver 3 is mediated by MDM2 and PIRH2.
19930715 2009 PRL-3 promotes the motility, invasion, and metastasis of LoVo colon cancer cells through PRL-3-integrin beta1-ERK1/2 and-MMP2 signaling.
19846928 2009 PTP4A3 expression increases strongly in lymph node metastases from colorectal carcinoma.
19757198 2010 Expression and prognostic value of PRL-3 in human intrahepatic cholangiocarcinoma.
19586538 2009 PRL-3 overexpression in epithelial cells is induced by surrounding stromal fibroblasts.
19440036 2009 PRL-3 promotes epithelial mesenchymal transition by regulating cadherin directly.
19424625 2009 Phosphatase of regenerating liver-3 as a prognostic biomarker in histologically node-negative gastric cancer.
19322925 2009 Expression of phosphatase regenerating liver 3 is an independent prognostic indicator for gastric cancer.
19236507 2009 Prognostic value of PRL-3 overexpression in early stages of colonic cancer.
19214221 2009 Phosphatase of regenerating liver-3 localizes to cyto-membrane and is required for B16F1 melanoma cell metastasis in vitro and in vivo.
19187591 2008 Role of silencing phosphatase of regenerationg liver-3 expression by microRNA interference in the growth of gastric cancer.
19152186 2009 PRL-3 facilitates angiogenesis and metastasis by increasing ERK phosphorylation and up-regulating the levels and activities of Rho-A/C in lung cancer.
19132388 2009 Elevated PRL-3 expression was more frequently detected in the large primary gastric cancer and exhibits a poor prognostic impact on the patients.
19115206 2009 Down-modulation of keratin 8 phosphorylation levels by PRL-3 contributes to colorectal carcinoma progression.
19101992 2009 Over-expression of phosphatase of regenerating liver-3 correlates with tumor progression and poor prognosis in nasopharyngeal carcinoma.
19087692 2008 [Expression of phosphatase of regenerating liver-3 in gastric cancer, its relationship with prognosis, and its role in gastric cancer cell proliferation].
19040419 2009 Analysis of molecular determinants of PRL-3.
19009246 2009 High expression of PRL-3 can promote growth of gastric cancer and exhibits a poor prognostic impact on patients.
19002188 2008 PRL-3 is essentially overexpressed in primary colorectal tumours and associates with tumour aggressiveness.
18813812 2008 Liver metastasis of colorectal cancer by protein-tyrosine phosphatase type 4A, 3 (PRL-3) is mediated through lymph node metastasis and elevated serum tumor markers such as CEA and CA19-9.
18803057 2008 [Expression of phosphatase of regeneration liver-3 in human colorectal carcinoma and its prognosis value].
18684031 2008 Expression of phosphatase of regenerating liver 1 and 3 mRNA in esophageal squamous cell carcinoma.
18636172 2008 Evaluation of PRL-3 expression, and its correlation with angiogenesis and invasion in hepatocellular carcinoma.
18561324 2008 Expression and prognostic impact of PRL-3 in lymph node metastasis of gastric cancer: its molecular mechanism was investigated using artificial microRNA interference.
18268019 2008 Translational control of C-terminal Src kinase (Csk) expression by PRL3 phosphatase.
18078820 2008 Ezrin is a specific and direct target of protein tyrosine phosphatase PRL-3.
18021371 2007 The value and correlation between PRL-3 expression and matrix metalloproteinase activity and expression in human gliomas.
17934070 2008 Overexpression and involvement in migration by the metastasis-associated phosphatase PRL-3 in human myeloma cells.
17717498 2007 Down-regulation of the human PRL-3 gene is associated with the metastasis of primary non-small cell lung cancer.
17545077 2007 [Cloning of human PRL-3 gene and construction of its prokaryotic expression vector].
17545014 2007 [Preliminary study of PRL-3 gene promoter binding sites of Snail in SW480 cells].
17440740 2007 Expression of the human phosphatases of regenerating liver (PRLs) in colonic adenocarcinoma and its correlation with lymph node metastasis.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17235563 2007 High PRL-3 expression in human gastric cancer is a marker of metastasis and grades of malignancies: an in situ hybridization study.
17018620 2006 PRL-3 initiates tumor angiogenesis by recruiting endothelial cells in vitro and in vivo.
16873432 2006 Overexpression of phosphatase of regenerating liver-3 in breast cancer: association with a poor clinical outcome.
16832410 2006 Expression and prognostic impact of the protein tyrosine phosphatases PRL-1, PRL-2, and PRL-3 in breast cancer.
16505094 2006 Protein tyrosine phosphatase PRL-3 in malignant cells and endothelial cells: expression and function.
16472776 2006 Identification of integrin alpha1 as an interacting protein of protein tyrosine phosphatase PRL-3.
16203771 2005 PRL-3 phosphatase is implicated in ovarian cancer growth.
15788667 2005 Generation of PRL-3- and PRL-1-specific monoclonal antibodies as potential diagnostic markers for cancer metastases.
15534108 2004 High expression of PRL-3 promotes cancer cell motility and liver metastasis in human colorectal cancer: a predictive molecular marker of metachronous liver and lung metastases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15161639 2004 Phosphatase of regenerating liver-3 promotes motility and metastasis of mouse melanoma cells.
15135076 2004 Structure of human PRL-3, the phosphatase associated with cancer metastasis.
14704153 2004 Structural insights into molecular function of the metastasis-associated phosphatase PRL-3.
14654542 2003 PRL-3 expression in metastatic cancers.
12782572 2003 PRL-3 and PRL-1 promote cell migration, invasion, and metastasis.
12516958 2002 Pentamidine is an inhibitor of PRL phosphatases with anticancer activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12235145 2002 The tyrosine phosphatase PRL-1 localizes to the endoplasmic reticulum and the mitotic spindle and is required for normal mitosis.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.
11598267 2001 A phosphatase associated with metastasis of colorectal cancer.
11355880 2001 Role of PRL-3, a human muscle-specific tyrosine phosphatase, in angiotensin-II signaling.
10747914 2000 Prenylation-dependent association of protein-tyrosine phosphatases PRL-1, -2, and -3 with the plasma membrane and the early endosome.
9633825 1997 Multiple phosphotyrosine phosphatase mRNAs are expressed in the human lung fibroblast cell line WI-38.
9514946 1998 Mouse PRL-2 and PRL-3, two potentially prenylated protein tyrosine phosphatases homologous to PRL-1.