Property Summary

Ligand Count 2
NCBI Gene PubMed Count 32
PubMed Score 212.67
PubTator Score 93.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Breast cancer 2.600 3.4e-02
Down syndrome 1.400 8.3e-04
esophageal adenocarcinoma 1.400 2.2e-02
lung adenocarcinoma 1.178 1.4e-04
lung cancer -1.500 8.4e-03
Multiple myeloma 1.408 1.9e-03
osteosarcoma 1.584 2.2e-05
ovarian cancer -2.000 2.5e-07
Pick disease 1.400 6.9e-05
psoriasis -1.100 1.8e-02
Rheumatoid arthritis 1.400 1.0e-02
tuberculosis and treatment for 3 months 1.100 1.4e-06
Waldenstrons macroglobulinemia 1.352 3.8e-03

Protein-protein Interaction (8)

Gene RIF (13)

AA Sequence

MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDG      1 - 70
APPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNS     71 - 140
KQLLYLEKYRPKMRLRFRDTNGHCCVQ                                               141 - 167
//

Text Mined References (35)

PMID Year Title