Property Summary

NCBI Gene PubMed Count 31
PubMed Score 206.65
PubTator Score 93.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid Arthritis 1.400 1.0e-02
Waldenstrons macroglobulinemia 1.352 3.8e-03
Multiple myeloma 1.431 1.3e-03
esophageal adenocarcinoma 1.800 1.9e-02
psoriasis -1.900 2.2e-05
osteosarcoma 1.584 2.2e-05
tuberculosis and treatment for 3 months 1.100 1.4e-06
lung cancer -1.500 8.4e-03
Breast cancer 2.600 3.4e-02
lung adenocarcinoma 1.178 1.4e-04
Pick disease 1.400 6.9e-05
ovarian cancer 2.600 4.3e-06
Down syndrome 1.400 8.3e-04

Protein-protein Interaction (7)

Gene RIF (13)

PMID Text
25193986 Our findings highlight the important role of miR-29c in regulating CRC EMT via GSK-3b/b-catenin signaling by targeting GNA13 and PTP4A and provide new insights into the metastatic basis of colorectal cancer
23568563 PTP4A2 expression is correlated with overall survival in progestin receptor-positive breast carcinomas.
23362275 Results suggest that TRP32 maintains the reduced state of PRL and thus regulates the biological function of PRL.
22413991 Studies indicate that PRL-1 and PRL-2 and PRL-3 are oncogenes and belong to the few phosphatases that lead to the development of cancer.
21993571 PRL-2 plays an important role in lung cancer and can be a biomarker of lung cancer, substituting for the function of other PRLs.
21765462 Results suggest a model in which PRL-2 promotes cell migration and invasion through an ERK1/2-dependent signaling pathway.
20841483 Overexpression of the protein tyrosine phosphatase PRL-2 correlates with breast tumor formation and progression.
20226699 Mouse pre-B-cells transfected with human PRL-2 had higher growth responses to Epo or IL-3, shorter cell cycle, less Epo requirement for survival, more cell migration, less cell adhesion, change to an immature cell morphology, & more Bmi-1 expression.
17666324 PRL-2 can promote cell adhesion and invasion activity of human hepatocellular carcinoma cells.
17440740 Colonic adenocarcinoma cells have the ability to produce PTP4A1, PTP4a2, and PTP4A3, which may relate to the lymph node metastasis of colonic adenocarcinoma.
16957164 PRL-2 was expressed heavily in almost every tissue and cell type examined. Widespread expression of PRL-2 in multiple organ systems suggests an important functional role for these enzymes in normal tissue homeostasis.
16832410 PRL-2 mRNA expression was not significantly higher in malignant compared to benign breast tissue.
14643450 PRL phosphatases increase cell proliferation by stimulating progression from G1 into S phase

AA Sequence

MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDG      1 - 70
APPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNS     71 - 140
KQLLYLEKYRPKMRLRFRDTNGHCCVQ                                               141 - 167
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25193986 2014 MiR-29c mediates epithelial-to-mesenchymal transition in human colorectal carcinoma metastasis via PTP4A and GNA13 regulation of ?-catenin signaling.
23568563 2013 Protein tyrosine phosphatase 4A2 expression predicts overall and disease-free survival of human breast cancer and is associated with estrogen and progestin receptor status.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23362275 2013 Thioredoxin-related protein 32 (TRP32) specifically reduces oxidized phosphatase of regenerating liver (PRL).
22413991 2013 Molecular mechanisms of the PRL phosphatases.
21993571 2012 Altered expression of phosphatase of regenerating liver gene family in non-small cell lung cancer.
21765462 2012 Metastasis-associated phosphatase PRL-2 regulates tumor cell migration and invasion.
21269460 2011 Initial characterization of the human central proteome.
20841483 2010 Overexpression of the protein tyrosine phosphatase PRL-2 correlates with breast tumor formation and progression.
20226699 2010 PRL-2 increases Epo and IL-3 responses in hematopoietic cells.
17666324 2007 [Construction of an eukaryotic expression vector for PRL-2 and its effect on human hepatocellular carcinoma cell invasiveness and migration in vitro].
17440740 2007 Expression of the human phosphatases of regenerating liver (PRLs) in colonic adenocarcinoma and its correlation with lymph node metastasis.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16957164 2006 Cellular localization of PRL-1 and PRL-2 gene expression in normal adult human tissues.
16832410 2006 Expression and prognostic impact of the protein tyrosine phosphatases PRL-1, PRL-2, and PRL-3 in breast cancer.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14643450 2003 Enhanced cell cycle progression and down regulation of p21(Cip1/Waf1) by PRL tyrosine phosphatases.
12516958 2002 Pentamidine is an inhibitor of PRL phosphatases with anticancer activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12235145 2002 The tyrosine phosphatase PRL-1 localizes to the endoplasmic reticulum and the mitotic spindle and is required for normal mitosis.
11734337 2002 Analysis of stromal-epithelial interactions in prostate cancer identifies PTPCAAX2 as a potential oncogene.
11447212 2001 Interaction of farnesylated PRL-2, a protein-tyrosine phosphatase, with the beta-subunit of geranylgeranyltransferase II.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10940933 2000 Subcellular localization of intracellular protein tyrosine phosphatases in T cells.
9514946 1998 Mouse PRL-2 and PRL-3, two potentially prenylated protein tyrosine phosphatases homologous to PRL-1.
9018080 1996 Prenylation of oncogenic human PTP(CAAX) protein tyrosine phosphatases.
8661118 1996 Characterization and genomic mapping of genes and pseudogenes of a new human protein tyrosine phosphatase.
8529999 1995 A 100-kb physical and transcriptional map around the EDH17B2 gene: identification of three novel genes and a pseudogene of a human homologue of the rat PRL-1 tyrosine phosphatase.
7490091 1995 Generation of a transcription map at the HSD17B locus centromeric to BRCA1 at 17q21.