Property Summary

NCBI Gene PubMed Count 46
PubMed Score 65.80
PubTator Score 55.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
gastric cancer -1.700 2.8e-04
hepatocellular carcinoma -1.300 6.3e-04
pancreatic cancer -1.500 3.9e-04
interstitial lung disease -1.400 7.2e-03
Multiple myeloma 2.506 1.2e-03
urothelial carcinoma -1.200 3.4e-02
psoriasis 1.800 7.5e-05
cutaneous lupus erythematosus 1.100 2.3e-02
osteosarcoma 1.983 5.3e-05
group 4 medulloblastoma 1.900 1.4e-03
astrocytoma -1.100 3.5e-02
Duchenne muscular dystrophy -1.141 2.7e-04
hereditary spastic paraplegia -1.585 7.1e-03
juvenile dermatomyositis -1.141 2.1e-07
limb girdle muscular dystrophy 2A -1.254 1.1e-04
pancreatic ductal adenocarcinoma liver m... -1.940 2.1e-02
lung cancer -2.800 3.0e-06
colon cancer -1.500 3.5e-03
Breast cancer 4.800 2.2e-02
non primary Sjogren syndrome sicca 1.100 3.3e-02
pancreatic carcinoma -1.500 3.9e-04
lung adenocarcinoma 1.843 8.2e-05
breast carcinoma 1.100 7.8e-12
Alzheimer's disease -1.100 1.6e-02
Pick disease -1.300 7.9e-04
progressive supranuclear palsy -1.100 2.1e-02
invasive ductal carcinoma 1.600 4.7e-03
ovarian cancer 1.600 2.2e-03
dermatomyositis -2.400 8.9e-04

Gene RIF (23)

PMID Text
25003523 Data highlight the oncogenic function of PRL-1 in HCC invasion and metastasis.
24968948 Data indicate that protein-tyrosine-phosphatase of regenerating liver 1 (PRL1) gene was expressed much more highly in prostate cancer (PCa) than in nonneoplastic prostate samples.
24961364 We confirmed with our previous findings that PTP4A1-PHF3-EYS variants were significantly associated with alcohol dependence.
24939702 Upregulation of PRL-1 expression is inversely correlated with miR-26a in primary cervical cancer tissues.
23362275 Results suggest that TRP32 maintains the reduced state of PRL and thus regulates the biological function of PRL.
23324950 PTP4A1-PHF3-EYS variants were associated with alcohol dependence.
22484636 upregulation of PRL-1 protein correlates with shortened patient survival in human hepatocellular carcinoma
22413991 Studies indicate that PRL-1 and PRL-2 and PRL-3 are oncogenes and belong to the few phosphatases that lead to the development of cancer.
22096494 Data conclude that the PHF3-PTP4A1 region appears to harbor a causal locus for alcohol dependence, and proteins encoded by PHF3 and/or PTP4A1 might play a functional role in the disorder.
22009749 PRL-1 binding to p115 RhoGAP provides a coordinated mechanism underlying ERK1/2 and RhoA activation
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
19341304 phosphatase of regenerating liver activity is controlled by the redox environment and its C-terminal residues
19199380 Increased PRL1 expression results in activation of Src and ERK1/2, which stimulates MMP2 and MMP9 production, leading to increased cell migration and invasion.
18997816 the new oncogenic p53 target, PRL-1, may contribute to tumor development by the downregulation of p53 by a negative feedback mechanism.
18684031 PRL-1 and PRL-3 mRNAs may be involved in and used to predict the metastasis of esophageal squamous cell carcinoma. Possibility of using PRL-1 and PRL-3 as therapeutical target.
18038187 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17656357 that trimerization may be a general property for all PRL enzymes, and that PRL1 trimer formation is essential for the PRL1-mediated cell growth and migration.
17440740 Colonic adenocarcinoma cells have the ability to produce PTP4A1, PTP4a2, and PTP4A3, which may relate to the lymph node metastasis of colonic adenocarcinoma.
16957164 PRL-1 expression levels varied considerably both between tissue types and cell type examined. Widespread expression of PRL-1 in multiple organ systems suggests an important functional role for these enzymes in normal tissue homeostasis.
16832410 PRL-1 mRNA expression was not significantly higher in malignant compared to benign breast tissue.
15571731 PRL-1 phosphatase has a trimeric structure which reveals an active enzyme conformation and regulation mechanisms
14643450 PRL phosphatases increase cell proliferation by stimulating progression from G1 into S phase
12235145 PRL-1 function is regulated in a cell cycle-dependent manner and implicate PRL-1 in regulating progression through mitosis, possibly by modulating spindle dynamics

AA Sequence

MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPF      1 - 70
DDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGA     71 - 140
FNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ                                         141 - 173
//

Text Mined References (50)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25621764 2015 Translation of 5' leaders is pervasive in genes resistant to eIF2 repression.
25003523 2014 Oncogenic function and prognostic significance of protein tyrosine phosphatase PRL-1 in hepatocellular carcinoma.
24968948 2014 Identification of PRL1 as a novel diagnostic and therapeutic target for castration-resistant prostate cancer by the Escherichia coli ampicillin secretion trap (CAST) method.
24961364 Common PTP4A1-PHF3-EYS variants are specific for alcohol dependence.
24939702 2014 MicroRNA-26a inhibits cell proliferation and invasion of cervical cancer cells by targeting protein tyrosine phosphatase type IVA 1.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23362275 2013 Thioredoxin-related protein 32 (TRP32) specifically reduces oxidized phosphatase of regenerating liver (PRL).
23324950 2013 Association of rare PTP4A1-PHF3-EYS variants with alcohol dependence.
22484636 2012 Increased expression of PRL-1 protein correlates with shortened patient survival in human hepatocellular carcinoma.
22413991 2013 Molecular mechanisms of the PRL phosphatases.
22096494 2011 A novel, functional and replicable risk gene region for alcohol dependence identified by genome-wide association study.
22009749 2011 PRL-1 protein promotes ERK1/2 and RhoA protein activation through a non-canonical interaction with the Src homology 3 domain of p115 Rho GTPase-activating protein.
21707506 2012 Impact of oncogenic protein tyrosine phosphatases in cancer.
21269460 2011 Initial characterization of the human central proteome.
21053359 2010 PRL-3 phosphatase and cancer metastasis.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
19341304 2009 Enzyme activity of phosphatase of regenerating liver is controlled by the redox environment and its C-terminal residues.
19199380 2009 PRL1 promotes cell migration and invasion by increasing MMP2 and MMP9 expression through Src and ERK1/2 pathways.
18997816 2009 New p53 target, phosphatase of regenerating liver 1 (PRL-1) downregulates p53.
18684031 2008 Expression of phosphatase of regenerating liver 1 and 3 mRNA in esophageal squamous cell carcinoma.
18224294 2008 PRL PTPs: mediators and markers of cancer progression.
18038187 2008 Joint effect between regular use of non-steroidal anti-inflammatory drugs, variants in inflammatory genes and risk of lymphoma.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17656357 2007 Phosphatase activity, trimerization, and the C-terminal polybasic region are all required for PRL1-mediated cell growth and migration.
17440740 2007 Expression of the human phosphatases of regenerating liver (PRLs) in colonic adenocarcinoma and its correlation with lymph node metastasis.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16957164 2006 Cellular localization of PRL-1 and PRL-2 gene expression in normal adult human tissues.
16832410 2006 Expression and prognostic impact of the protein tyrosine phosphatases PRL-1, PRL-2, and PRL-3 in breast cancer.
16142898 2005 Structure and biochemical properties of PRL-1, a phosphatase implicated in cell growth, differentiation, and tumor invasion.
15571731 2005 Trimeric structure of PRL-1 phosphatase reveals an active enzyme conformation and regulation mechanisms.
15501285 2004 Potential effects of tetrodotoxin exposure to human glial cells postulated using microarray approach.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14643450 2003 Enhanced cell cycle progression and down regulation of p21(Cip1/Waf1) by PRL tyrosine phosphatases.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12782572 2003 PRL-3 and PRL-1 promote cell migration, invasion, and metastasis.
12516958 2002 Pentamidine is an inhibitor of PRL phosphatases with anticancer activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12235145 2002 The tyrosine phosphatase PRL-1 localizes to the endoplasmic reticulum and the mitotic spindle and is required for normal mitosis.
11971983 2002 Tyrosine phosphorylation regulates alpha II spectrin cleavage by calpain.
11447212 2001 Interaction of farnesylated PRL-2, a protein-tyrosine phosphatase, with the beta-subunit of geranylgeranyltransferase II.
11278933 2001 ATF-7, a novel bZIP protein, interacts with the PRL-1 protein-tyrosine phosphatase.
10940933 2000 Subcellular localization of intracellular protein tyrosine phosphatases in T cells.
10747914 2000 Prenylation-dependent association of protein-tyrosine phosphatases PRL-1, -2, and -3 with the plasma membrane and the early endosome.
10569806 1999 Differential gene expression in tumorigenic and nontumorigenic HeLa x normal human fibroblast hybrid cells.
9642300 1998 The gene encoding human nuclear protein tyrosine phosphatase, PRL-1. Cloning, chromosomal localization, and identification of an intron enhancer.
9633825 1997 Multiple phosphotyrosine phosphatase mRNAs are expressed in the human lung fibroblast cell line WI-38.
9018080 1996 Prenylation of oncogenic human PTP(CAAX) protein tyrosine phosphatases.