Property Summary

NCBI Gene PubMed Count 44
PubMed Score 269.34
PubTator Score 123.98

Knowledge Summary

Patent (18,315)

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma 2.461 3.3e-04
sonic hedgehog group medulloblastoma 2.000 1.4e-06
atypical teratoid / rhabdoid tumor 1.500 1.7e-05
glioblastoma 1.200 1.1e-04
medulloblastoma, large-cell 1.300 1.6e-04
primitive neuroectodermal tumor 1.100 1.2e-02
primary pancreatic ductal adenocarcinoma 1.291 8.4e-04
lung cancer 1.200 4.5e-03
colon cancer 1.200 1.7e-03
pediatric high grade glioma 1.100 2.2e-04
lung adenocarcinoma 1.134 6.0e-04

Pathway (1)

Gene RIF (28)

PMID Text
26549850 PTK7 enriches in self-renewing, multipotent stem cells of the human colon.
26368655 findings implicate PTK7 as a risk factor for NTDs and provide additional evidence for a pathogenic role of PCP signaling in these malformations
25986862 data demonstrates that PTK7 regulates the activity of KDR biphasically by inducing oligomerization of KDR molecules at lower concentrations and by surrounding KDR molecules at higher concentrations.
25962058 overexpression in PTK7-negative cancer cells led to increased metastatic events. PTK7 expression thus represents a potential prognostic biomarker and a novel therapeutic target in CRC.
25796105 PTK7 acts as a cancer-related gene and may be a potent prognostic marker for Hepatocellular carcinoma(HCC).
25550828 Expression level of PTK7 was significantly decreased from benign to malignant ovarian epithelial tumors. survival analysis showed that patients with negative expression of PTK7 protein had poorer outcome than those with positive expression.
25204555 PTK7 regulates Id1 expression in CD44-high glioma cell lines. Targeting PTK7 could be an effective strategy for treating glioma with high CD44 expression.
25006253 results provide convincing evidence that both PTK7 expression and proteolysis, rather than the level of the cellular full-length PTK7 alone, contribute to efficient directional cell motility and metastasis in cancer
24789704 Furthermore, we confirmed that these phenotypic changes are associated with the inactivation of AKT and ERK. Our findings suggest that PTK7 has different oncogenic roles in organs and target tumors.
24741114 The results suggest that N-acylethanolamine acid amidase and protein tyrosine kinase 7 may be used as potential tissue biomarkers to avoid overtreatment of non-aggressive prostate cancer
24654231 This work defines PTK7 as a highly and specifically expressed gene in adenocarcinoma and a potential therapeutic target in this subset of NSCLC.
24587299 PTK7 expression plays an important role in the invasiveness of intrahepatic cholangiocarcinoma (ICC) cells and leads to a poor prognosis in ICC patients.
24409301 PTK 7 is a transforming gene and prognostic marker for breast cancer and nodal metastasis involvement.
24023307 in patients treated by chemotherapy, patients with PTK7-negative tumors seemed to have better DFS than those with PTK7-positive tumors, particularly for patients treated with only anthracycline-therapy drugs
23663482 Increased expression of PTK7 was inversely correlated with overall survival.
23209741 PTK7 is a novel marker of epithelial to mesenchymal transitions
23095747 cleavage of the PTK7 ectodomain by an ADAM proteinase was coupled with the membrane type-1 matrix metalloproteinase (MT1-MMP) cleavage of the PKP(621) downward arrowLI site in the seventh Ig-like domain of PTK7.
22898210 PTK7 has utility as a biomarker for detecting minimal residual disease of T cell acute lymphoblastic leukemia in the bone marrow
22665490 a novel role for PTK7 in the tumorigenesis via generation of PTK7-CTF2 by sequential cleavage of ADAM17 and gamma-secretase.
21518755 aberrations in the membrane type 1 matrix metalloproteinase/PTK7 axis are detrimental to cell movements that shape the body plan
21132015 Protein Tyrosine Kinase 7 is required for beta-catenin-dependent transcriptional events induced by canonical Wnt ligands
21103379 Observations may indicate a role for PTK7 in cell proliferation and cell apoptosis and may provide a potential therapeutic pathway for the treatment of a variety of cancers.
20837484 Results indicate that PTK7 is a major target of MT1-MMP.
20558616 PTK7 is a planar cell polarity component expressed in the myeloid progenitor compartment that conveys promigratory and antiapoptotic signals into the cell and represents an independent prognosis factor in patients treated with induction chemotherapy.
18471990 PTK7 plays an important role not only in tube formation, migration, and invasion of endothelial cells but also in angiogenesis.
17671748 mechanism of PTK7 upregulation in colorectal cancer
15683231 Lack of a thermodynamically meaningful self-association propensity for the CCK4 transmembrane domains demonstrates that the conserved GxxxG motif is not sufficient to drive CCK4 transmembrane helix-helix interactions.
12427550 cloning, sequencing and expression of gene and its splice variants

AA Sequence

MGAARGSPARPRRLPLLSVLLLPLLGGTQTAIVFIKQPSSQDALQGRRALLRCEVEAPGPVHVYWLLDGA      1 - 70
PVQDTERRFAQGSSLSFAAVDRLQDSGTFQCVARDDVTGEEARSANASFNIKWIEAGPVVLKHPASEAEI     71 - 140
QPQTQVTLRCHIDGHPRPTYQWFRDGTPLSDGQSNHTVSSKERNLTLRPAGPEHSGLYSCCAHSAFGQAC    141 - 210
SSQNFTLSIADESFARVVLAPQDVVVARYEEAMFHCQFSAQPPPSLQWLFEDETPITNRSRPPHLRRATV    211 - 280
FANGSLLLTQVRPRNAGIYRCIGQGQRGPPIILEATLHLAEIEDMPLFEPRVFTAGSEERVTCLPPKGLP    281 - 350
EPSVWWEHAGVRLPTHGRVYQKGHELVLANIAESDAGVYTCHAANLAGQRRQDVNITVATVPSWLKKPQD    351 - 420
SQLEEGKPGYLDCLTQATPKPTVVWYRNQMLISEDSRFEVFKNGTLRINSVEVYDGTWYRCMSSTPAGSI    421 - 490
EAQARVQVLEKLKFTPPPQPQQCMEFDKEATVPCSATGREKPTIKWERADGSSLPEWVTDNAGTLHFARV    491 - 560
TRDDAGNYTCIASNGPQGQIRAHVQLTVAVFITFKVEPERTTVYQGHTALLQCEAQGDPKPLIQWKGKDR    561 - 630
ILDPTKLGPRMHIFQNGSLVIHDVAPEDSGRYTCIAGNSCNIKHTEAPLYVVDKPVPEESEGPGSPPPYK    631 - 700
MIQTIGLSVGAAVAYIIAVLGLMFYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALT    701 - 770
SLGSGPAATNKRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLVLVKSLQSKDEQQQ    771 - 840
LDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQPLSTKQKVAL    841 - 910
CTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILE    911 - 980
GDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKARLPQPEGCPSKLYRLMQRCWALSPKD    981 - 1050
RPSFSEIASALGDSTVDSKP                                                     1051 - 1070
//

Text Mined References (50)

PMID Year Title
26549850 2015 Isolation of Human Colon Stem Cells Using Surface Expression of PTK7.
26368655 2015 Role of the planar cell polarity gene Protein tyrosine kinase 7 in neural tube defects in humans.
25986862 2015 Biphasic effect of PTK7 on KDR activity in endothelial cells and angiogenesis.
25962058 2015 Overexpression of the Promigratory and Prometastatic PTK7 Receptor Is Associated with an Adverse Clinical Outcome in Colorectal Cancer.
25796105 2015 Protein tyrosine kinase 7: a hepatocellular carcinoma-related gene detected by triple-combination array.
25550828 2014 PTK7 protein is decreased in epithelial ovarian carcinomas with poor prognosis.
25204555 2015 PTK7 regulates Id1 expression in CD44-high glioma cells.
25006253 2014 Protein-tyrosine pseudokinase 7 (PTK7) directs cancer cell motility and metastasis.
24789704 2014 Protein tyrosine kinase 7 plays a tumor suppressor role by inhibiting ERK and AKT phosphorylation in lung cancer.
24741114 2014 Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness.
24654231 2014 A meta-analysis of lung cancer gene expression identifies PTK7 as a survival gene in lung adenocarcinoma.
24587299 2014 High expression of protein tyrosine kinase 7 significantly associates with invasiveness and poor prognosis in intrahepatic cholangiocarcinoma.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24409301 2014 PTK 7 is a transforming gene and prognostic marker for breast cancer and nodal metastasis involvement.
24023307 2013 PTK7 expression in triple-negative breast cancer.
23663482 2013 Oncogenic role of protein tyrosine kinase 7 in esophageal squamous cell carcinoma.
23209741 2012 PTK7 marks the first human developmental EMT in vitro.
23095747 2012 Insights into ectodomain shedding and processing of protein-tyrosine pseudokinase 7 (PTK7).
22898210 2012 PTK7: a new biomarker for immunophenotypic characterization of maturing T cells and T cell acute lymphoblastic leukemia.
22665490 2012 The cytosolic domain of protein-tyrosine kinase 7 (PTK7), generated from sequential cleavage by a disintegrin and metalloprotease 17 (ADAM17) and ?-secretase, enhances cell proliferation and migration in colon cancer cells.
22585737 2012 PTK7 as a novel marker for favorable gastric cancer patient survival.
22230326 2012 The many roles of PTK7: a versatile regulator of cell-cell communication.
21518755 2011 Potential relation of aberrant proteolysis of human protein tyrosine kinase 7 (PTK7) chuzhoi by membrane type 1 matrix metalloproteinase (MT1-MMP) to congenital defects.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21415598 2011 PTK7: a cell polarity receptor with multiple facets.
21269460 2011 Initial characterization of the human central proteome.
21132015 2011 Protein tyrosine kinase 7 has a conserved role in Wnt/?-catenin canonical signalling.
21103379 2010 Silencing of PTK7 in colon cancer cells: caspase-10-dependent apoptosis via mitochondrial pathway.
20837484 2010 The Wnt/planar cell polarity protein-tyrosine kinase-7 (PTK7) is a highly efficient proteolytic target of membrane type-1 matrix metalloproteinase: implications in cancer and embryogenesis.
20558616 2010 The cell polarity PTK7 receptor acts as a modulator of the chemotherapeutic response in acute myeloid leukemia and impairs clinical outcome.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18471990 2008 Soluble PTK7 inhibits tube formation, migration, and invasion of endothelial cells and angiogenesis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17910947 2007 Identification of twinfilin-2 as a factor involved in neurite outgrowth by RNAi-based screen.
17671748 2007 Comparative integromics on non-canonical WNT or planar cell polarity signaling molecules: transcriptional mechanism of PTK7 in colorectal cancer and that of SEMA6A in undifferentiated ES cells.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15683231 2005 The GxxxG-containing transmembrane domain of the CCK4 oncogene does not encode preferential self-interactions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12427550 2002 Organization of the human PTK7 gene encoding a receptor protein tyrosine kinase-like molecule and alternative splicing of its mRNA.
9154124 1997 Assignment of PTK7 encoding a receptor protein tyrosine kinase-like molecule to human chromosome 6p21.1-->p12.2 by fluorescence in situ hybridization.
8882711 1996 Characterization of the human full-length PTK7 cDNA encoding a receptor protein tyrosine kinase-like molecule closely related to chick KLG.
8247543 1993 A survey of protein tyrosine kinase mRNAs expressed in normal human melanocytes.
7478540 1995 Colon carcinoma kinase-4 defines a new subclass of the receptor tyrosine kinase family.