Property Summary

NCBI Gene PubMed Count 240
PubMed Score 516.10
PubTator Score 792.31

Knowledge Summary

Patent (41,373)

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma -1.100 4.8e-16
oligodendroglioma -1.200 4.8e-15
osteosarcoma -2.402 1.9e-06
ependymoma -1.400 5.2e-10
glioblastoma -1.400 2.4e-06
group 4 medulloblastoma -2.000 1.1e-05
atypical teratoid/rhabdoid tumor -2.100 8.8e-10
medulloblastoma, large-cell -2.400 6.2e-07
primitive neuroectodermal tumor -1.800 1.0e-05
adult high grade glioma -1.500 4.4e-04
pilocytic astrocytoma -1.600 3.3e-06
subependymal giant cell astrocytoma -1.868 1.3e-02
lung carcinoma 1.100 1.1e-16
Pick disease -1.400 1.0e-02

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1641 confirmatory 93 / 0 / 118 TR-FRET counterscreen for FAK inhibitors: dose-response biochemical high throughput screening assay to identify inhibitors of Proline-rich tyrosine kinase 2 (Pyk2)
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (169)

PMID Text
26866924 Src has a role in priming Pyk2 (but not FAK) phosphorylation and subsequent activation downstream of integrins
26866573 Pyk2-focal adhesion targeting domain interacts with and binds to leupaxin.
26352169 Pyk2 is a key downstream signaling molecules of CCR7 in SCCHN, which promotes SCCHN tumorigenesis and progression.
26330541 Phosphoproteomic analysis identifies FAK2 as a potential therapeutic target for tamoxifen resistance in breast cancer.
26274564 FAK and PYK2 functioned redundantly to promote the Wnt/beta-catenin pathway by phosphorylating GSK3beta(Y216) to reinforce pathway output-beta-catenin accumulation and intestinal tumorigenesis.
26202465 Data strongly suggest that chemokine-stimulated associations between Vav1, SLP-76, and ADAP facilitate Rac1 activation and alpha4beta1-mediated adhesion, whereas Pyk2 opposes this adhesion by limiting Rac1 activation.
26109718 This study identified Pyk2 as a cellular component required for the intracellular trafficking of HPV16 during infection.
26084289 Studies suggest that PYK2 is a common downstream effector of ErbB and IL8 receptors, and that PYK2 integrates their signaling pathways through a positive feedback loop to potentiate breast cancer invasion.
25967238 Fyn, but not Lyn, was required for complete Pyk2 phosphorylation by thrombin.
25889845 These results suggest that melatonin exerts anti-migratory and anti-invasive effects on glioma cells in response to hypoxia via reactive oxygen species-alphavbeta3 integrin-FAK/Pyk2 signaling pathways.
25778396 Pyk2 has a role in integrin regulation of size and dynamics of signaling microclusters
25433371 Orai1/Pyk2 pathway is essential for glioma migration and invasion.
25415317 data suggest a novel role for FAK in GPVI-dependent ROS formation and platelet activation and elucidate a proximal signaling role for FAK within the GPVI pathway.
25387834 these data demonstrate that Pyk2 is a critical regulator of PI3K function downstream of the TCR.
25231990 SMS2 is involved in HIV-1 gp120-induced phosphorylation and activation of PYK2 and polymerization of F-actin
25219547 Pyk2-NDRG1 axis is possibly involved in conveying the anti-proliferative effect of beta-ionone in prostate cancer cells.
25217697 Data indicate the tumor-promoting role of proline-rich tyrosine kinase 2 (Pyk2) in multiple myeloma (MM), suggesting tyrosine kinase inhibitor as a therapeutic option in MM.
25180269 PYK2 is an intermediary component of Ca(2+) signaling between PKA-mediated and Tyr phosphorylations that is required for achieving functional human sperm capacitation.
25174335 Data indicate that chicken paxillin leucine-aspartate LD2 and LD4 motifs preferentially dock at the helix 2/3 binding site of human Proline-rich tyrosine kinase 2 (Pyk2)-focal adhesion kinase (FAK).
24965120 SMS2 is involved in HIV-1 gp120-induced phosphorylation and activation of PYK2 and polymerization of F-actin
24598361 Pyk2 is essential for skin wound reepithelialization in vivo and in vitro and that it regulates epidermal keratinocyte migration via a pathway that requires PKCdelta and MMP functions.
24523919 inhibition of FAK, PYK2 and BCL-XL synergistically enhances apoptosis in ovarian clear cell carcinoma cell lines
24413044 SMS2 is involved in HIV-1 gp120-induced phosphorylation and activation of PYK2 and polymerization of F-actin
24413044 Knockdown of protein tyrosine kinase 2 beta (PTK2B) by siRNA enhances HIV-1 infectivity in Jurkat cells
24176282 Pyk2 is a shared key mediator of targeted-therapy induced adhesion and migration; Targeting Pyk2 may serve as an effective therapeutic strategy to reduce extramedullar relpase in acute promyelocytic leukemia and chronic myeloid leukemia.
24142406 Pyk2 and Src are important in CCL18-induced breast cancer metastasis.
24108181 We hypothesize a potential direct or indirect role for SRC, RAF1, PTK2B genes in neurotransmission and in central nervous system signaling processes.
24097630 Development of a coordinated allo T cell and auto B cell response against autosomal PTK2B after allogeneic hematopoietic stem cell transplantation.
24072693 Determine a crucial role of LRP1-mediated Pyk2 phosphorylation on hypoxia-induced MMP-9 activation and hVSMC migration and therefore in hypoxia-induced vascular remodeling.
23986795 SMS2 is involved in HIV-1 gp120-induced phosphorylation and activation of PYK2 and polymerization of F-actin
23922106 Both Pyk2 and phosphorylated Pyk2[pY881] are potential prognostic factors and therapeutic targets for non-small-cell lung cancer.
23618355 Our results confirm that RTKs are frequently altered in chordomas.
23587524 Results indicate that in vitro Pyk2 might function to regulate cell adhesion and motility following all-trans-retinoic acid (ATRA).
23302305 SOCS3 definitely plays roles in regulating Pyk2 signaling and cell motility in A549 cells.
23300847 the non-catalytic functions of the kinases Fyn and Pyk2 were required for late stage human T cell adhesion.
23292187 Data indicate protein secretion pathways activated by monosodium urate (MSU) in macrophages, and reveal a novel role for cathepsin B and Src, Pyk2, PI3 kinases in the activation of unconventional protein secretion.
23220172 We conclude that the effects of selenoprotein H on mitochondrial biogenesis and mitochondrial function are probably mediated through protein kinase A-CREB-PGC-1alpha and Akt/protein kinase B-CREB-PGC-1alpha pathways.
23216754 These results identify a novel pathway of integrin alphaIIbbeta3 outside-in signaling and recognize the tyrosine kinase Pyk2 as a major regulator of platelet adhesion and spreading on fibrinogen.
23142219 Down-regulation of both miR-517a and miR-517c contribute to hepatocellular carcinoma cells development through regulating Pyk2.
23119100 SMS2 is involved in HIV-1 gp120-induced phosphorylation and activation of PYK2 and polymerization of F-actin
22923218 findings showed that Pyk2 is overexpressed in squamous cell carcinoma of the head and neck; data suggest that CCR7 via Pyk2 and cofilin regulates the chemotaxis and migration ability of metastatic squamous cell carcinoma of the head and neck cells
22922962 Pyk2 plays a crucial role in G protein-coupled receptor agonist thrombin-induced human aortic smooth muscle cell growth and migration, as well as balloon injury-induced neointima formation.
22859931 Pyk2, which was strongly activated by IGF-I, was critical for IGF-IR-dependent motility.
22842493 Pyk2 as a critical regulator of endothelial cell inflammation by virtue of engaging IKK to promote the release and the transcriptional capacity of RelA/p65.
22745829 duced expression of miR-23b enhances glioma cell migration in vitro and invasion ex vivo via modulation of Pyk2 protein expression.
22618716 High expression of proline-rich tyrosine kinase 2 is associated with hepatocellular carcinoma via regulating phosphatidylinositol 3-kinase/AKT pathway.
22581436 PAC1 regulates PYK-2 tyrosine phosphorylation in a calcium-dependent manner in lung cancer cell lines.
22454420 Report safety, pharmacokinetic, and pharmacodynamic phase I dose-escalation trial of PF-00562271, an inhibitor of focal adhesion kinases, in advanced solid tumors.
22190034 SMS2 is involved in HIV-1 gp120-induced phosphorylation and activation of PYK2 and polymerization of F-actin
22188814 Data show that c-Met induces FAK and Pyk2 phosphorylation in medulloblastoma cells.
22096562 Results may suggest a new evidence of Pyk2 on promoting cisplatin resistance of HCC cells through preventing cell apoptosis, activation of AKT pathway and upregulation of drug resistant genes.
22023045 This is a review of recent developments in Protein kinase B/AKT and focal adhesion kinase signaling in cancer with the particular emphasis on the novel signaling pathways in which FAK is downstream of AKT. [review]
21840393 ATP stimulates epithelial cell motility through Pyk2-mediated activation of the EGF receptor
21666110 Activation of Pyk2 in the heart during heart failure may contribute to protection against arrhythmia.
21640103 The results suggest a surprising finding that limited cell adhesion can enhance endothelial responsiveness to VEGF and demonstrate a novel role for Pyk2 in the adhesive regulation of angiogenesis.
21602932 downregulation of endogenous FIP200 protein in glioblastoma tumor cells, astrocytes, and brain microvessel endothelial cells promotes apoptosis, most likely due to the removal of a direct interaction of FIP200 with Pyk2 that inhibits Pyk2 activation
21533080 data provided new evidence of the underlying mechanism of Pyk2 in controlling cell motility of HCC cells through regulation of genes associated with EMT
21426305 although staurosporine-mediated caspase activation and FAK cleavage was delayed in the mtp53-R 175H HOSCC cell line, caspase-8 activation and FAK dephosphorylation were induced by increasing the apoptotic stimulus.
21357692 Nephrocystin-4 regulates Pyk2-induced tyrosine phosphorylation of nephrocystin-1 to control targeting to monocilia
21114537 Both wild-type and internal tandem duplication (ITD)-FLT3 proteins co-immunoprecipitated with beta1 integrin and Pyk2 indicating the signal crosstalk between FLT3, beta1 integrin and Pyk2.
20966971 Studies suggest that FAK FERM domains might mediate information transfer between the cell cortex and nucleus.
20881009 TNFRSF19 overexpression in glioma cells activates Rac1 signaling in a Pyk2-dependent manner to drive glioma cell invasion and migration
20849950 The Pyk2 FERM domain is involved in the regulation of Pyk2 activity by acting to regulate the formation of Pyk2 oligomers that are critical for Pyk2 activity.
20842205 SMS2 is involved in HIV-1 gp120-induced phosphorylation and activation of PYK2 and polymerization of F-actin
20800603 Observational study of gene-disease association. (HuGE Navigator)
20724588 Phosphorylation of focal adhesion kinase at Tyr397 is associated with gastric carcinomas.
20688918 Pyk2 acts as an early sensor of numerous extracellular signals that trigger a Ca(2+) flux and/or reactive oxygen species to amplify tyrosine phosphorylation signaling events.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20543098 Data show that knockdown of SOCS2 resulted in the accumulation of p-Pyk2(Tyr402) and blocked NK cell effector functions.
20381867 Data show that Pyk2 had a second burst of phosphorylation 30-60 min after TCR stimulation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20308428 The p110alpha selectively mediates activation of the Tyr kinase Pyk2 to regulate barrier function.
20215112 activation of Pyk2 is an early signal that promotes wound healing by stimulating the SFK/EGFR signaling pathway.
20180987 Data reveal that Pyk2 couples the activation mGluRs to the ERK1/2 mitogen-activated protein kinase pathway even though it attenuates mGluR1-dependent G protein signaling.
20074345 The data demonstrated that Pyk2 and PECAM-1 were critical mediators of both anchorage-independent growth and anoikis resistance in tumor cells.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20028775 TCR has a distinct pathway for the activation of Pyk2 compared with other receptor systems.
19930834 Upregulation of serum proline-rich tyrosine kinase 2 is associated with systemic lupus erythematosus.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19880522 Pyk2 functions to limit p53 levels, thus facilitating cell growth and survival in a kinase-independent manner.
19718025 Observational study of gene-disease association. (HuGE Navigator)
19706888 Induction of PTK2B antigen is associated with relapsed chronic myeloid leukemia.
19700666 SMS2 is involved in HIV-1 gp120-induced phosphorylation and activation of PYK2 and polymerization of F-actin
19561089 Pyk2 and FAK are downstream targets of the Rap GTPases that play a key role in regulating B cell morphology.
19509258 Data substantiate a central role for the FERM domain in regulation of Pyk2 activity and identify the F3 module as a novel target to inhibit Pyk2 activity and inhibit glioma progression.
19458494 Studies indicated that the roles of FAK in tumorigenesis are different among the tumor species.
19415692 PRL up-regulated CHIT-1 expression via PTK, PI3-K, MAPK, and signaling transduction components.
19358827 These results demonstrate that Pyk2 is constitutively associated with paxillin, that neither Tyr-881 nor kinase activity is necessary for the Pyk2/paxillin association, and that paxillin is a substrate of Pyk2 kinase.
19207108 Pyk2 is a critical signalling molecule downstream of beta3 integrin tyrosine phosphorylation and mediates Vav1 recruitment to accomplish actin reorganization necessary for adhesion
19106639 Pyk2 and cAMP interact in regulating prostate cell functions and in "keeping" prostate identity.
19086031 Data suggest that endothelin-1 stimulates the GTPase Rap1 by a mechanism involving Pyk2 activation and recruitment of the p130Cas/BCAR3 complex in human glomerular mesangial cells.
19047047 PYK2 activity is abnormally up-regulated in the Pcdh-gamma-deficient neurons
18954908 a critical role for the Pyk2 mediated pathway involving p38 MAP kinase and NF-kappaB in LPS-induced MCP-1 production in human microvascular endothelial cells.
18832579 These data support the cooperative function of Pyk2 and FAK in breast cancer progression and suggest that dual inhibition of FAK and Pyk2 is an efficient therapeutic approach for targeting invasive breast cancer.
18794150 Results indicate that RhoC promotes tumor metastasis in prostate cancer by activation of Pyk2.
18765415 Immunofluorescence staining showed that the focal adhesion localization of Pyk2 is a major determinant for c-Src and ERK/MAPK activation. Pyk2 promoted cell proliferation and invasiveness by upregulation of the c-Src and ERK/MAPK-signaling pathways
18667434 In vascular smooth muscle cells shedding of membrane-bound epidermal growth factor (EGF) receptor ligands and activation of the nonreceptor tyrosine kinases Pyk2 and Src contributed to the thrombin-induced ERK1/2 phosphorylation.
18632858 SMS2 is involved in HIV-1 gp120-induced phosphorylation and activation of PYK2 and polymerization of F-actin
18571765 Up-regulation of proline-rich tyrosine kinase 2 is associated with non-small cell lung cancer.
18453587 SMS2 is involved in HIV-1 gp120-induced phosphorylation and activation of PYK2 and polymerization of F-actin
18437915 FAK is a critical decision maker in extracellular matrix/strain-enhanced osteogenic differentiation.
18390748 these results demonstrate a novel role for Pyk2 in LPS-induced IL-8 production in endothelial cells
18367725 Pyk2 is activated by beta(2)-integrin adhesion and is a required signal for eosinophil spreading and subsequent chemotactic migration
18365874 Pyk2/ERK 1/2 mediate Sp1- and c-Myc-dependent induction of telomerase activity by epidermal growth factor
18198130 Pyk2 is induced and involved in monocyte differentiation and C/EBPbeta is a critical regulator of the Pyk2 expression.
18075463 Observational study of gene-disease association. (HuGE Navigator)
18075463 Missense mutation in PTK2B gene is associated with hypertension
17950644 Observational study of gene-disease association. (HuGE Navigator)
17906699 Proline-rich tyrosine kinase Pyk2 is highly expressed in small cell lung cancer cells and provides a functional link between neuropeptide-induced increases in intracellular calcium ions [Ca2+]i, and tumor cell proliferation.
17785844 Endothelial Pyk2 activity is required for efficient neutrophil migration and to facilitate junctional disruption during transcellular or paracellular passage of the leukocyte across the vascular endothelial monolayer.
17716864 Protein kinase B mediates its anti-apoptotic activities in cells through mitochondrial dynamics and their role during apoptosis.
17581868 REVIEW: role of PYK2 in bone resorption and possible target to prevent osteoporosis
17563746 ErbB-2, via PYK2-MAP kinase, upregulates the adhesive ability of androgen receptor human prostate cancer cells.
17551499 overexpression of Pyk2 and FAK was found in nearly 60% of HCC patients and was significantly correlated with poor prognosis
17537919 PYK2 regulates osteoprogenitor cells and bone formation, and offes an anablic treatment for osteoporosis.
17329398 These data demonstrate that LPXN forms a signaling complex with Pyk2, c-Src, and PTP-PEST to regulate migration of prostate cancer cells.
17205062 These results provide insights into Pyk2 signaling in epidermis and reveal a novel role for Pyk2 in regulation of keratinocyte differentiation.
16998626 FRNK plays an important role in cell adhesion during the very early stages of cell culture.
16949788 Focal adhesion kinase is involved type III group B streptococcal invasion of human brain microvascular endothelial cells.
16945503 Our data demonstrate that while FAK mediated cell adhesion, RAFTK was localized at the cytoplasm where it mediated inside-out signaling through intracellular Ca(2+), thus leading to cell spreading and movement upon EGF stimulation.
16840719 regulation of virus-induced Akt activation by the integrin-linked kinase in Hela cells
16783820 Our data indicate that Pyk2 plays a central role in the mechanism that regulate cell-cell and cell-substrate interaction and lack of its kinase activity induces prostate cells to acquire a malignant, migrating phenotype.
16774943 PYK2 mediates anti-apoptotic AKT signaling in response to benzo[a]pyrene diol epoxide in mammary epithelial cells
16760434 Vascular endothelial growth factor (VEGF) elicits the activation of the VEGFR2-ROCK pathway, leading to phosphorylation of Ser732 within FAK which changes the conformation of FAK, making it accessible to Pyk2.
16514607 The tyrosine kinase Pyk2 was highly phosphorylated upon induction of cell polarity but not during cell spreading
16433632 Pyk2 may mediate a signal necessary for beta2 integrin function in PMN tethered by E-selectin.
16055703 Semaphorin 4D/plexin-B1 induces endothelial cell migration through the activation of PYK2, Src, and the phosphatidylinositol 3-kinase-Akt pathway
15967096 Pyk2 plays a central role in the migratory behavior of glioblastomas
15944312 Pyk2 is a critical regulatory component and a molecular switch to overcome the suppression of neutrophil oxidant generation by cell adhesion.
15835820 bFGF significantly stimulated PKB activity in CNE- I nasopharyngeal carcinoma cell line.
15778498 Pyk2 has a role in the reduced cell-cell adhesion induced by the Rac-mediated production of ROS through the tyrosine phosphorylation of beta-catenin
15695828 Pyk2 is a phosphorylated beta(3) binding partner, providing a potential structural and signaling platform to achieve alpha(V)beta(3) -mediated remodeling of the actin cytoskele
15585656 proline-rich tyrosine kinase 2 (PYK2) is phosphorylated on tyrosine residues 402 and 580 induced by ephrin-A1
15539082 Activation of PI3K following beta1-integrin engagement on human CD34+ cells results in subsequent phosphorylation of PYK2, and is required for the recruitment of the PI3K/PYK2 complex to beta1-integrins at the cell surface.
15499613 Tyrosine phosphorylation of PYK2 mediates heregulin-induced glioma invasion
15213840 EGFR, PYK2, Yes, and SHP-2 are involved in transduction of the TF/FVIIa signal possibly via transactivation of the EGF receptor.
15128873 Recruitment of PYK2 to lipid rafts mediates signals important for actin reorganization in growing neurites.
15128501 modulation and phosphorylation of BK(Ca) channels by Pyk2 and a Src-family kinase may reflect a general cellular mechanism by which G protein-coupled receptor and/or integrin activation leads to the regulation of membrane ion channels
15105428 Pyk2 is a novel effector of fibroblast growth factor receptor 3 activation
15070849 Pyk2 signaling differentially regulates cell migration and proliferation pathways.
15050747 PYK2 gene products mediate integrin-induced signals that regulate myelopoiesis.
14969582 In P-selectin-activated PMNs, PYK-2 (proline-rich tyrosine kinase-2) undergoes tyrosine phosphorylation in a b2-integrin- and SRC-dependent manner, suggesting that this focal adhesion kinase may be a downstream mediator of the effect of SRC kinases.
14963038 Pyk2 facilitates EGFR- and c-Src-mediated Stat3 activation and has a role in triggering Stat3-induced oncogenesis
14961028 identified a BCR/ABL-dependent increase in expression of multiple genes involved in pre-mRNA splicing; alternative splicing of gene PYK2 resulted in increased expression of full-length Pyk2 in BCR/ABL-containing cells
14729602 Calcium signaling in ovarian surface epithelial cells not only induces telomerase activity via JNK but also activates Pyk2.
14676843 A novel regulatory network RAFTK/Pyk2, Src and p38 appears to be critical for VEGF-induced endothelial cell migration.
12960231 SMS2 is involved in HIV-1 gp120-induced phosphorylation and activation of PYK2 and polymerization of F-actin
12943720 results indicate that activation of PKC is responsible for GnRH-induced phosphorylation of both ERK1/2 and Pyk2, and that Pyk2 activation does not contribute to GnRH signaling
12933673 PKB is an essential component of the FSH-mediated granulosa cell differentiation and that both PKB and G(s)alpha signaling pathways are required.
12857973 SMS2 is involved in HIV-1 gp120-induced phosphorylation and activation of PYK2 and polymerization of F-actin
12844492 RAFTK is activated by VEGF in human brain microvascular endothelial cells
12794117 Augmented activation of Pyk2 is an immediate signaling event required for the trans-regulation of integrin alpha L beta 2 by alpha 4 beta 1 in Jurkat T cells.
12628756 SMS2 is involved in HIV-1 gp120-induced phosphorylation and activation of PYK2 and polymerization of F-actin
12626562 PYK2 regulates transendothelial migration of cultured NK cells in response to chemokines by controlling the activation of the small GTP binding protein Rac, and thus acts as an integration point between integrin and chemokine receptor stimulation.
12606503 results indicate that signaling via protein kinase B to forkhead transcription factor FKHR can account for the effect of insulin to regulate peroxisome proliferator-activated receptor-gamma coactivator-1 promoter activity via the insulin response sequence
12515814 Critical role of the carboxyl terminus of proline-rich tyrosine kinase (Pyk2) in the activation of human neutrophils by tumor necrosis factor: separation of signals for the respiratory burst and degranulation.
12458207 role in negative regulation of mixed lineage kinase 3 results in cell survival
12354773 SMS2 is involved in HIV-1 gp120-induced phosphorylation and activation of PYK2 and polymerization of F-actin
12244133 This protein binds to periplakin.
12077257 By rapidly translocating to the vicinity of the immune synapse after T cell receptor stimulation, Pyk2 plays an essential role in T cell activation and polarized secretion of cytokines.
12011061 Transforming growth factor-beta 2 is a transcriptional target via forkhead transcription factor
11916084 Pyk2 role in platelet activation by vWF in the early signal transduction events activated by ligand binding to glycoprotein Ib-IX-V.
11856738 Suppressees androgen receptor transactivation vir interaction and phosphorylation of ARA44 coregulator
11820787 Human umbilical vein endothelial cells express mRNA transcripts for both the full length isoform Pyk2 and the truncated isoform Pyk2-H containing the C-terminal deletion.
11774117 Glomerular crescents strongly expressed cell adhesion kinase beta.
10356363 SMS2 is involved in HIV-1 gp120-induced phosphorylation and activation of PYK2 and polymerization of F-actin
10194422 SMS2 is involved in HIV-1 gp120-induced phosphorylation and activation of PYK2 and polymerization of F-actin
9621077 SMS2 is involved in HIV-1 gp120-induced phosphorylation and activation of PYK2 and polymerization of F-actin
9362541 SMS2 is involved in HIV-1 gp120-induced phosphorylation and activation of PYK2 and polymerization of F-actin

AA Sequence

MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVKCTVQTEIREI      1 - 70
ITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYECLHVEAEWRYDLQIRYLPEDF     71 - 140
MESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGCLELRRFFKDMPHNALDKKSNFELLEKEVGL    141 - 210
DLFFPKQMQENLKPKQFRKMIQQTFQQYASLREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLV    211 - 280
IGPKGIRQLTSQDAKPTCLAEFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDG    281 - 350
YCRLQGEHQGSLIIHPRKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGI    351 - 420
AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKNLDHPHIVKLI    421 - 490
GIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYLESINCVHRDIAVRNILVASP    491 - 560
ECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFRRFTTASDVWMFAVCMWEILSFGKQPFFWLE    561 - 630
NKDVIGVLEKGDRLPKPDLCPPVLYTLMTRCWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYR    631 - 700
TPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHR    701 - 770
HNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP    771 - 840
LTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQLPPEGYVVVV    841 - 910
KNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTAS    911 - 980
HTLAVDAKNLLDAVDQAKVLANLAHPPAE                                             981 - 1009
//

Text Mined References (260)

PMID Year Title
26866924 2016 Novel Role of Src in Priming Pyk2 Phosphorylation.
26866573 2016 Structural Basis for the Interaction between Pyk2-FAT Domain and Leupaxin LD Repeats.
26352169 2015 The role of Pyk2 in the CCR7-mediated regulation of metastasis and viability in squamous cell carcinoma of the head and neck cells in vivo and in vitro.
26330541 2015 Phosphoproteomic Analysis Identifies Focal Adhesion Kinase 2 (FAK2) as a Potential Therapeutic Target for Tamoxifen Resistance in Breast Cancer.
26274564 2015 FAK/PYK2 promotes the Wnt/?-catenin pathway and intestinal tumorigenesis by phosphorylating GSK3?.
26202465 2015 Positive and negative regulation by SLP-76/ADAP and Pyk2 of chemokine-stimulated T-lymphocyte adhesion mediated by integrin ?4?1.
26109718 2015 A Dual Role for the Nonreceptor Tyrosine Kinase Pyk2 during the Intracellular Trafficking of Human Papillomavirus 16.
26084289 2015 PYK2 integrates growth factor and cytokine receptors signaling and potentiates breast cancer invasion via a positive feedback loop.
25967238 2015 The focal adhesion kinase Pyk2 links Ca2+ signalling to Src family kinase activation and protein tyrosine phosphorylation in thrombin-stimulated platelets.
25889845 2015 Involvement of ROS-alpha v beta 3 integrin-FAK/Pyk2 in the inhibitory effect of melatonin on U251 glioma cell migration and invasion under hypoxia.
25778396 2015 Integrins Influence the Size and Dynamics of Signaling Microclusters in a Pyk2-dependent Manner.
25433371 2014 Store-operated Ca(2+) entry regulates glioma cell migration and invasion via modulation of Pyk2 phosphorylation.
25415317 2014 Role of focal adhesion tyrosine kinases in GPVI-dependent platelet activation and reactive oxygen species formation.
25387834 2015 Proline-rich tyrosine kinase 2 controls PI3-kinase activation downstream of the T cell antigen receptor in human T cells.
25219547 2015 Quantitative phosphoproteomics reveals the protein tyrosine kinase Pyk2 as a central effector of olfactory receptor signaling in prostate cancer cells.
25217697 2014 Pyk2 promotes tumor progression in multiple myeloma.
25180269 2014 Evidence for the involvement of proline-rich tyrosine kinase 2 in tyrosine phosphorylation downstream of protein kinase A activation during human sperm capacitation.
25174335 2014 Structural and mechanistic insights into the interaction between Pyk2 and paxillin LD motifs.
24598361 2014 Delayed skin wound repair in proline-rich protein tyrosine kinase 2 knockout mice.
24523919 2014 Targeted inhibition of FAK, PYK2 and BCL-XL synergistically enhances apoptosis in ovarian clear cell carcinoma cell lines.
24176282 2013 Enhanced adhesion/migration and induction of Pyk2 expression in K562 cells following imatinib exposure.
24162737 2013 Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease.
24142406 2014 Pyk2 and Src mediate signaling to CCL18-induced breast cancer metastasis.
24108181 2013 Network analysis of neurotransmitter related human kinase genes: possible role of SRC, RAF1, PTK2B?
24097630 2014 Development of a coordinated allo T cell and auto B cell response against autosomal PTK2B after allogeneic hematopoietic stem cell transplantation.
24072693 2013 Hypoxia induces metalloproteinase-9 activation and human vascular smooth muscle cell migration through low-density lipoprotein receptor-related protein 1-mediated Pyk2 phosphorylation.
23922106 2013 Proline-rich tyrosine kinase 2 and its phosphorylated form pY881 are novel prognostic markers for non-small-cell lung cancer progression and patients' overall survival.
23618355 2013 Tyrosine kinase receptor expression in chordomas: phosphorylated AKT correlates inversely with outcome.
23587524 2013 Retinoic acid induces adhesion and migration in NB4 cells through Pyk2 signaling.
23302305 2012 [Expression of SOCS3 and Pyk2 and their correlation in non-small cell lung cancer].
23300847 2012 Non-catalytic functions of Pyk2 and Fyn regulate late stage adhesion in human T cells.
23292187 2013 Monosodium urate activates Src/Pyk2/PI3 kinase and cathepsin dependent unconventional protein secretion from human primary macrophages.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
23220172 2013 Overexpression of human selenoprotein H in neuronal cells enhances mitochondrial biogenesis and function through activation of protein kinase A, protein kinase B, and cyclic adenosine monophosphate response element-binding protein pathway.
23216754 2013 The proline-rich tyrosine kinase Pyk2 regulates platelet integrin ?IIb?3 outside-in signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23142219 2013 Down-regulation of miR-517a and miR-517c promotes proliferation of hepatocellular carcinoma cells via targeting Pyk2.
22923218 2012 Chemokine receptor 7 via proline-rich tyrosine kinase-2 upregulates the chemotaxis and migration ability of squamous cell carcinoma of the head and neck.
22922962 2012 Novel role of proline-rich nonreceptor tyrosine kinase 2 in vascular wall remodeling after balloon injury.
22859931 2012 Proline-rich tyrosine kinase 2 (Pyk2) regulates IGF-I-induced cell motility and invasion of urothelial carcinoma cells.
22842493 2012 Regulation of Rela/p65 and endothelial cell inflammation by proline-rich tyrosine kinase 2.
22745829 2012 miRNA expression profiling in migrating glioblastoma cells: regulation of cell migration and invasion by miR-23b via targeting of Pyk2.
22618716 2013 High expression of proline-rich tyrosine kinase 2 is associated with poor survival of hepatocellular carcinoma via regulating phosphatidylinositol 3-kinase/AKT pathway.
22581436 2012 PYK-2 is tyrosine phosphorylated after activation of pituitary adenylate cyclase activating polypeptide receptors in lung cancer cells.
22454420 2012 Safety, pharmacokinetic, and pharmacodynamic phase I dose-escalation trial of PF-00562271, an inhibitor of focal adhesion kinase, in advanced solid tumors.
22188814 2012 Cooperation between c-Met and focal adhesion kinase family members in medulloblastoma and implications for therapy.
22096562 2011 The role of proline rich tyrosine kinase 2 (Pyk2) on cisplatin resistance in hepatocellular carcinoma.
22023045 2011 Protein kinase B/AKT and focal adhesion kinase: two close signaling partners in cancer.
21840393 2011 Extracellular ATP stimulates epithelial cell motility through Pyk2-mediated activation of the EGF receptor.
21666110 2011 Role of Pyk2 in cardiac arrhythmogenesis.
21640103 2011 Decreased cell adhesion promotes angiogenesis in a Pyk2-dependent manner.
21602932 2011 Downregulation of FIP200 induces apoptosis of glioblastoma cells and microvascular endothelial cells by enhancing Pyk2 activity.
21533080 2011 Proline-rich tyrosine kinase 2 (Pyk2) promotes cell motility of hepatocellular carcinoma through induction of epithelial to mesenchymal transition.
21426305 2011 Delayed caspase-8 activation and enhanced integrin ?1-activated FAK underpins anoikis in oesophageal carcinoma cells harbouring mt p53-R175H.
21357692 2011 Nephrocystin-4 regulates Pyk2-induced tyrosine phosphorylation of nephrocystin-1 to control targeting to monocilia.
21269460 2011 Initial characterization of the human central proteome.
21245381 2011 Neuropilin-1 signaling through p130Cas tyrosine phosphorylation is essential for growth factor-dependent migration of glioma and endothelial cells.
21196189 2011 Redox sensitive Pyk2 as a target for therapeutics in breast cancer.
21114537 2011 FLT3/?ITD regulates leukaemia cell adhesion through ?4?1 integrin and Pyk2 signalling.
20966971 2010 The FERM domain: organizing the structure and function of FAK.
20881009 2010 TROY (TNFRSF19) is overexpressed in advanced glial tumors and promotes glioblastoma cell invasion via Pyk2-Rac1 signaling.
20849950 2011 The Pyk2 FERM regulates Pyk2 complex formation and phosphorylation.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20724588 2010 Phosphorylation of focal adhesion kinase at Tyr397 in gastric carcinomas and its clinical significance.
20688918 2010 Regulation of the tyrosine kinase Pyk2 by calcium is through production of reactive oxygen species in cytotoxic T lymphocytes.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20543098 2010 Suppressor of cytokine signaling 2 regulates IL-15-primed human NK cell function via control of phosphorylated Pyk2.
20521079 2010 Recruitment of Pyk2 to SHPS-1 signaling complex is required for IGF-I-dependent mitogenic signaling in vascular smooth muscle cells.
20381867 2010 T cell receptor activation leads to two distinct phases of Pyk2 activation and actin cytoskeletal rearrangement in human T cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20332118 2010 Cellular functions of FAK kinases: insight into molecular mechanisms and novel functions.
20308428 2010 The PI3K p110alpha isoform regulates endothelial adherens junctions via Pyk2 and Rac1.
20215112 2010 Pyk2 activation triggers epidermal growth factor receptor signaling and cell motility after wounding sheets of epithelial cells.
20180987 2010 Pyk2 uncouples metabotropic glutamate receptor G protein signaling but facilitates ERK1/2 activation.
20074345 2010 Cell aggregation induces phosphorylation of PECAM-1 and Pyk2 and promotes tumor cell anchorage-independent growth.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20028775 2010 The T cell receptor-mediated phosphorylation of Pyk2 tyrosines 402 and 580 occurs via a distinct mechanism than other receptor systems.
20001213 2010 Targeting Pyk2 for therapeutic intervention.
19930834 Expression and activation of proline-rich tyrosine kinase 2 (PYK2) in peripheral blood mononuclear cells from patients with systemic lupus erythematosus.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19880522 2010 Pyk2 inhibition of p53 as an adaptive and intrinsic mechanism facilitating cell proliferation and survival.
19718025 2009 Analysis of the tyrosine kinome in melanoma reveals recurrent mutations in ERBB4.
19706888 2009 Identification of 4 new HLA-DR-restricted minor histocompatibility antigens as hematopoietic targets in antitumor immunity.
19648005 2009 Identification of small molecule inhibitors of proline-rich tyrosine kinase 2 (Pyk2) with osteogenic activity in osteoblast cells.
19561089 2009 B cell receptor-induced phosphorylation of Pyk2 and focal adhesion kinase involves integrins and the Rap GTPases and is required for B cell spreading.
19509258 2009 The Pyk2 FERM domain as a target to inhibit glioma migration.
19458494 2009 Silencing of focal adhesion kinase by tumor direct injection of small interfering RNA decreases in vivo tumor growth.
19428251 2009 Sulfoximine-substituted trifluoromethylpyrimidine analogs as inhibitors of proline-rich tyrosine kinase 2 (PYK2) show reduced hERG activity.
19415692 2009 Prolactin induces chitotriosidase expression in human macrophages through PTK, PI3-K, and MAPK pathways.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19358827 2009 Crystal structures of free and ligand-bound focal adhesion targeting domain of Pyk2.
19244237 2009 Structural characterization of proline-rich tyrosine kinase 2 (PYK2) reveals a unique (DFG-out) conformation and enables inhibitor design.
19207108 2009 A Pyk2-Vav1 complex is recruited to beta3-adhesion sites to initiate Rho activation.
19106639 2009 cAMP and Pyk2 interact to regulate prostate cell proliferation and function.
19086031 2009 Pyk2 mediates endothelin-1 signaling via p130Cas/BCAR3 cascade and regulates human glomerular mesangial cell adhesion and spreading.
19047047 2009 alpha- and gamma-Protocadherins negatively regulate PYK2.
18954908 2009 LPS-induced MCP-1 expression in human microvascular endothelial cells is mediated by the tyrosine kinase, Pyk2 via the p38 MAPK/NF-kappaB-dependent pathway.
18951788 2008 Trifluoromethylpyrimidine-based inhibitors of proline-rich tyrosine kinase 2 (PYK2): structure-activity relationships and strategies for the elimination of reactive metabolite formation.
18832579 2008 Focal adhesion kinase-related proline-rich tyrosine kinase 2 and focal adhesion kinase are co-overexpressed in early-stage and invasive ErbB-2-positive breast cancer and cooperate for breast cancer cell tumorigenesis and invasiveness.
18794150 2008 RhoC promotes metastasis via activation of the Pyk2 pathway in prostate cancer.
18765415 2008 Proline-rich tyrosine kinase 2 (Pyk2) promotes proliferation and invasiveness of hepatocellular carcinoma cells through c-Src/ERK activation.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18667434 2008 The transactivated epidermal growth factor receptor recruits Pyk2 to regulate Src kinase activity.
18587400 2008 Nonmuscle myosin light-chain kinase mediates neutrophil transmigration in sepsis-induced lung inflammation by activating beta2 integrins.
18571765 2008 Up-regulation of proline-rich tyrosine kinase 2 in non-small cell lung cancer.
18437915 2007 Focal adhesion kinase signaling controls cyclic tensile strain enhanced collagen I-induced osteogenic differentiation of human mesenchymal stem cells.
18390748 2008 The tyrosine kinase Pyk2 mediates lipopolysaccharide-induced IL-8 expression in human endothelial cells.
18367725 2008 Proline-rich tyrosine kinase 2 regulates spreading and migration of eosinophils after beta2-integrin adhesion.
18365874 2008 Pyk2/ERK 1/2 mediate Sp1- and c-Myc-dependent induction of telomerase activity by epidermal growth factor.
18339875 2008 Antitumor activity and pharmacology of a selective focal adhesion kinase inhibitor, PF-562,271.
18198130 2008 Induction of proline-rich tyrosine kinase2 (Pyk2) through C/EBPbeta is involved in PMA-induced monocyte differentiation.
18088087 2008 Phosphoproteome of resting human platelets.
18086875 2008 The atypical Rho GTPase Wrch1 collaborates with the nonreceptor tyrosine kinases Pyk2 and Src in regulating cytoskeletal dynamics.
18075463 2007 Protein tyrosine kinase 2beta as a candidate gene for hypertension.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17950644 2008 Identification of a functional protein kinase Cbeta promoter polymorphism in humans related to insulin resistance.
17910947 2007 Identification of twinfilin-2 as a factor involved in neurite outgrowth by RNAi-based screen.
17906699 2008 Essential role of Pyk2 and Src kinase activation in neuropeptide-induced proliferation of small cell lung cancer cells.
17785844 2007 ICAM-1-mediated, Src- and Pyk2-dependent vascular endothelial cadherin tyrosine phosphorylation is required for leukocyte transendothelial migration.
17716864 2008 PKB and the mitochondria: AKTing on apoptosis.
17634955 2007 Ephrin-A1 stimulates migration of CD8+CCR7+ T lymphocytes.
17581868 2007 Breaking new ground to build bone.
17563746 2007 ErbB-2 via PYK2 upregulates the adhesive ability of androgen receptor-positive human prostate cancer cells.
17551499 2007 The significance of proline-rich tyrosine kinase2 (Pyk2) on hepatocellular carcinoma progression and recurrence.
17537919 2007 Proline-rich tyrosine kinase 2 regulates osteoprogenitor cells and bone formation, and offers an anabolic treatment approach for osteoporosis.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17329398 2007 Interaction of Pyk2 and PTP-PEST with leupaxin in prostate cancer cells.
17205062 2007 The role of proline-rich protein tyrosine kinase 2 in differentiation-dependent signaling in human epidermal keratinocytes.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
16998626 2006 Expression of FAK-related non-kinase (FRNK) coincides with morphological change in the early stage of cell adhesion.
16949788 Focal adhesion kinase is involved in type III group B streptococcal invasion of human brain microvascular endothelial cells.
16945503 2007 RAFTK/Pyk2 regulates EGF-induced PC12 cell spreading and movement.
16840719 2006 Novel role for integrin-linked kinase in modulation of coxsackievirus B3 replication and virus-induced cardiomyocyte injury.
16783820 2006 Loss of proline-rich tyrosine kinase 2 function induces spreading and motility of epithelial prostate cells.
16774943 2006 PYK2 mediates anti-apoptotic AKT signaling in response to benzo[a]pyrene diol epoxide in mammary epithelial cells.
16760434 2006 Phosphorylation of focal adhesion kinase (FAK) on Ser732 is induced by rho-dependent kinase and is essential for proline-rich tyrosine kinase-2-mediated phosphorylation of FAK on Tyr407 in response to vascular endothelial growth factor.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16514607 2006 Activation pathways of alpha4beta1 integrin leading to distinct T-cell cytoskeleton reorganization, Rac1 regulation and Pyk2 phosphorylation.
16433632 2006 Src-family kinases mediate an outside-in signal necessary for beta2 integrins to achieve full activation and sustain firm adhesion of polymorphonuclear leucocytes tethered on E-selectin.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16055703 2005 Semaphorin 4D/plexin-B1 induces endothelial cell migration through the activation of PYK2, Src, and the phosphatidylinositol 3-kinase-Akt pathway.
15967096 2005 The tyrosine kinase pyk2 promotes migration and invasion of glioma cells.
15944312 2005 Critical role of proline-rich tyrosine kinase 2 in reversion of the adhesion-mediated suppression of reactive oxygen species generation by human neutrophils.
15888917 2005 Focal adhesion kinase-related protein tyrosine kinase Pyk2 in T-cell activation and function.
15881658 2005 Angiotensin II stimulated transcription of cyclooxygenase II is regulated by a novel kinase cascade involving Pyk2, MEKK4 and annexin II.
15835820 2004 [Effects of basic fibroblast growth factor on protein kinase B activity and c-fos expression in CNE- I nasopharyngeal carcinoma cell line].
15778498 2005 Proline-rich tyrosine kinase 2 (Pyk2) mediates vascular endothelial-cadherin-based cell-cell adhesion by regulating beta-catenin tyrosine phosphorylation.
15695828 2005 Tyrosine phosphorylation of beta3 integrin provides a binding site for Pyk2.
15661758 2005 Characterization of the nephrocystin/nephrocystin-4 complex and subcellular localization of nephrocystin-4 to primary cilia and centrosomes.
15588985 2005 Substrate-trapping techniques in the identification of cellular PTP targets.
15585656 2005 Ephrin-A1 binding to CD4+ T lymphocytes stimulates migration and induces tyrosine phosphorylation of PYK2.
15539082 2004 Phosphatidylinositol-3-kinase activation mediates proline-rich tyrosine kinase 2 phosphorylation and recruitment to beta1-integrins in human CD34+ cells.
15499613 2005 Tyrosine phosphorylation of PYK2 mediates heregulin-induced glioma invasion: novel heregulin/HER3-stimulated signaling pathway in glioma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15213840 2004 The epidermal growth factor receptor (EGFR) and proline rich tyrosine kinase 2 (PYK2) are involved in tissue factor dependent factor VIIa signalling in HaCaT cells.
15166227 2004 RAFTK/Pyk2 activation is mediated by trans-acting autophosphorylation in a Src-independent manner.
15128873 2004 Recruitment of Pyk2 and Cbl to lipid rafts mediates signals important for actin reorganization in growing neurites.
15128501 2004 The calcium-dependent activity of large-conductance, calcium-activated K+ channels is enhanced by Pyk2- and Hck-induced tyrosine phosphorylation.
15105428 2004 The cytoplasmic tyrosine kinase Pyk2 as a novel effector of fibroblast growth factor receptor 3 activation.
15070849 2004 Differential regulation of cell migration and proliferation through proline-rich tyrosine kinase 2 in endothelial cells.
15050747 2004 Integrin engagement-induced inhibition of human myelopoiesis is mediated by proline-rich tyrosine kinase 2 gene products.
14969582 2004 SRC-dependent outside-in signalling is a key step in the process of autoregulation of beta2 integrins in polymorphonuclear cells.
14963038 2004 Pyk2 amplifies epidermal growth factor and c-Src-induced Stat3 activation.
14961028 2004 p210BCR/ABL-induced alteration of pre-mRNA splicing in primary human CD34+ hematopoietic progenitor cells.
14729602 2004 Phosphatidylinositol triphosphate kinase-dependent and c-jun NH2-terminal kinase-dependent induction of telomerase by calcium requires Pyk2.
14684825 2003 Genome-wide survey of human alternative pre-mRNA splicing with exon junction microarrays.
14676843 2004 Vascular endothelial growth factor-mediated activation of p38 is dependent upon Src and RAFTK/Pyk2.
14585963 2003 Pyk2- and Src-dependent tyrosine phosphorylation of PDK1 regulates focal adhesions.
12943720 2003 Activation and nuclear translocation of PKCdelta, Pyk2 and ERK1/2 by gonadotropin releasing hormone in HEK293 cells.
12933673 2003 Protein kinase B is obligatory for follicle-stimulating hormone-induced granulosa cell differentiation.
12893833 2003 Identification and characterization of a novel Pyk2/related adhesion focal tyrosine kinase-associated protein that inhibits alpha-synuclein phosphorylation.
12844492 2003 Vascular endothelial growth factor regulates focal adhesion assembly in human brain microvascular endothelial cells through activation of the focal adhesion kinase and related adhesion focal tyrosine kinase.
12794117 2003 Paxillin binding to the alpha 4 integrin subunit stimulates LFA-1 (integrin alpha L beta 2)-dependent T cell migration by augmenting the activation of focal adhesion kinase/proline-rich tyrosine kinase-2.
12771146 2003 The tyrosine kinase Pyk2 regulates Arf1 activity by phosphorylation and inhibition of the Arf-GTPase-activating protein ASAP1.
12626562 2003 Proline-rich tyrosine kinase 2 and Rac activation by chemokine and integrin receptors controls NK cell transendothelial migration.
12606503 2003 Regulation of PGC-1 promoter activity by protein kinase B and the forkhead transcription factor FKHR.
12578912 2003 Regulation of the formation of osteoclastic actin rings by proline-rich tyrosine kinase 2 interacting with gelsolin.
12576483 2003 Interaction of the tyrosine kinase Pyk2 with the N-methyl-D-aspartate receptor complex via the Src homology 3 domains of PSD-95 and SAP102.
12522270 2003 Profiling of tyrosine phosphorylation pathways in human cells using mass spectrometry.
12515814 2003 Critical role of the carboxyl terminus of proline-rich tyrosine kinase (Pyk2) in the activation of human neutrophils by tumor necrosis factor: separation of signals for the respiratory burst and degranulation.
12486027 2003 A novel hematopoietic adaptor protein, Chat-H, positively regulates T cell receptor-mediated interleukin-2 production by Jurkat cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12458207 2003 Negative regulation of mixed lineage kinase 3 by protein kinase B/AKT leads to cell survival.
12244133 2002 Binding of protein kinase B to the plakin family member periplakin.
12231407 2002 Calcitonin induces dephosphorylation of Pyk2 and phosphorylation of focal adhesion kinase in osteoclasts.
12096713 2002 Activation of Pyk2/RAFTK induces tyrosine phosphorylation of alpha-synuclein via Src-family kinases.
12082274 2002 Integrins and cell signaling in chondrocytes.
12063569 2002 Csk homologous kinase associates with RAFTK/Pyk2 in breast cancer cells and negatively regulates its activation and breast cancer cell migration.
12011061 2002 Transforming growth factor-beta 2 is a transcriptional target for Akt/protein kinase B via forkhead transcription factor.
11916084 2002 Proline-rich tyrosine kinase 2 and focal adhesion kinase are involved in different phases of platelet activation by vWF.
11856738 2002 Suppression of androgen receptor transactivation by Pyk2 via interaction and phosphorylation of the ARA55 coregulator.
11850124 2002 Proline-rich tyrosine kinase 2 regulates proliferation and differentiation of prostate cells.
11820787 2002 Human endothelial Pyk2 is expressed in two isoforms and associates with paxillin and p130Cas.
11818507 2002 Requirement of Ca(2+) and PKCdelta for Janus kinase 2 activation by angiotensin II: involvement of PYK2.
11774117 2002 Increased expression of cell adhesion kinase beta in human and rat crescentic glomerulonephritis.
11751905 2002 Vascular endothelial growth factor-induced migration of multiple myeloma cells is associated with beta 1 integrin- and phosphatidylinositol 3-kinase-dependent PKC alpha activation.
11744621 2002 Multiple phosphorylation of alpha-synuclein by protein tyrosine kinase Syk prevents eosin-induced aggregation.
11739373 2002 Signal transduction of physiological concentrations of vasopressin in A7r5 vascular smooth muscle cells. A role for PYK2 and tyrosine phosphorylation of K+ channels in the stimulation of Ca2+ spiking.
11683411 2001 Podosomes in osteoclast-like cells: structural analysis and cooperative roles of paxillin, proline-rich tyrosine kinase 2 (Pyk2) and integrin alphaVbeta3.
11668182 2001 Role of tyrosine phosphorylation in ligand-independent sequestration of CXCR4 in human primary monocytes-macrophages.
11493697 2001 Nephrocystin interacts with Pyk2, p130(Cas), and tensin and triggers phosphorylation of Pyk2.
11478920 2001 NMDA receptor activation results in tyrosine phosphorylation of NMDA receptor subunit 2A(NR2A) and interaction of Pyk2 and Src with NR2A after transient cerebral ischemia and reperfusion.
11461120 2001 MIP-1alpha induces activation of phosphatidylinositol-3 kinase that associates with Pyk-2 and is necessary for B-cell migration.
11352632 2001 Carbachol stimulates TYR phosphorylation and association of PKCdelta and PYK2 in pancreas.
11337490 2001 Inhibition of the catalytic activity of cell adhesion kinase beta by protein-tyrosine phosphatase-PEST-mediated dephosphorylation.
11311138 2001 Monocyte chemoattractant protein 1 causes differential signalling mediated by proline-rich tyrosine kinase 2 in THP-1 cells.
11278472 2001 3-Hydroxy-3-methylglutaryl-CoA reductase inhibitors block calcium-dependent tyrosine kinase Pyk2 activation by angiotensin II in vascular endothelial cells. involvement of geranylgeranylation of small G protein Rap1.
11238453 2001 Regulation of CDC42 GTPase by proline-rich tyrosine kinase 2 interacting with PSGAP, a novel pleckstrin homology and Src homology 3 domain containing rhoGAP protein.
11162638 2001 Activated Fyn phosphorylates alpha-synuclein at tyrosine residue 125.
11149930 2001 Cbl associates with Pyk2 and Src to regulate Src kinase activity, alpha(v)beta(3) integrin-mediated signaling, cell adhesion, and osteoclast motility.
11036077 2001 Outside-in signaling pathway linked to CD146 engagement in human endothelial cells.
11007796 2000 Glucose activates mitogen-activated protein kinase (extracellular signal-regulated kinase) through proline-rich tyrosine kinase-2 and the Glut1 glucose transporter.
10961871 2000 Pyk2 and Syk participate in functional activation of granulocytic HL-60 cells in a different manner.
10880513 2000 SHP2 mediates the protective effect of interleukin-6 against dexamethasone-induced apoptosis in multiple myeloma cells.
10867021 2000 Protein-tyrosine kinase Pyk2 is involved in interleukin-2 production by Jurkat T cells via its tyrosine 402.
10821841 2000 G13alpha-mediated PYK2 activation. PYK2 is a mediator of G13alpha -induced serum response element-dependent transcription.
10797305 2000 Thrombin-stimulated phosphatidylinositol 3-kinase activity in platelets is associated with activation of PYK2 tyrosine kinase: activation of both enzymes is aggregation independent.
10777553 2000 Carbachol-stimulated transactivation of epidermal growth factor receptor and mitogen-activated protein kinase in T(84) cells is mediated by intracellular Ca2+, PYK-2, and p60(src).
10769033 2000 Suppression of Pyk2 kinase and cellular activities by FIP200.
10747947 2000 Beta-chemokine receptor CCR5 signals through SHP1, SHP2, and Syk.
10713673 2000 RAFTK/Pyk2 tyrosine kinase mediates the association of p190 RhoGAP with RasGAP and is involved in breast cancer cell invasion.
10708762 2000 Identification of a novel protein complex containing annexin VI, Fyn, Pyk2, and the p120(GAP) C2 domain.
10702271 2000 Interleukin (IL)-7 induces rapid activation of Pyk2, which is bound to Janus kinase 1 and IL-7Ralpha.
10521452 1999 Negative regulation of PYK2/related adhesion focal tyrosine kinase signal transduction by hematopoietic tyrosine phosphatase SHPTP1.
10518561 1999 Molecular cloning of a docking protein, BRDG1, that acts downstream of the Tec tyrosine kinase.
10354709 1999 Signaling through focal adhesion kinase.
10329689 1999 Adaptor proteins Grb2 and Crk couple Pyk2 with activation of specific mitogen-activated protein kinase cascades.
10322114 1999 Tyrosine kinase Pyk2 mediates G-protein-coupled receptor regulation of the Ewing sarcoma RNA-binding protein EWS.
10022920 1999 Identification of a new Pyk2 target protein with Arf-GAP activity.
10022914 1999 Identification of a novel family of targets of PYK2 related to Drosophila retinal degeneration B (rdgB) protein.
9750131 1998 Dot far-western blot analysis of relative binding affinities of the Src homology 3 domains of Efs and its related proteins.
9621077 1998 Human immunodeficiency virus tat modulates the Flk-1/KDR receptor, mitogen-activated protein kinases, and components of focal adhesion in Kaposi's sarcoma cells.
9565592 1998 Leupaxin is a novel LIM domain protein that forms a complex with PYK2.
9560226 1998 Activation of protein tyrosine kinase PYK2 by the m1 muscarinic acetylcholine receptor.
9545257 1998 A calcium-dependent tyrosine kinase splice variant in human monocytes. Activation by a two-stage process involving adherence and a subsequent intracellular signal.
9512511 1998 Pyk2 is a downstream mediator of the IL-2 receptor-coupled Jak signaling pathway.
9446638 1998 Beta-chemokine receptor CCR5 signals via the novel tyrosine kinase RAFTK.
9442086 1998 Differential regulation of Pyk2 and focal adhesion kinase (FAK). The C-terminal domain of FAK confers response to cell adhesion.
9422762 1998 Cell adhesion kinase beta forms a complex with a new member, Hic-5, of proteins localized at focal adhesions.
9402324 1997 Characterization of the novel focal adhesion kinase RAFTK in hematopoietic cells.
9242628 1997 The related adhesion focal tyrosine kinase differentially phosphorylates p130Cas and the Cas-like protein, p105HEF1.
9104812 1997 Tyrosine phosphorylation of Pyk2 is selectively regulated by Fyn during TCR signaling.
9099734 1997 Tyrosine phosphorylation of the related adhesion focal tyrosine kinase in megakaryocytes upon stem cell factor and phorbol myristate acetate stimulation and its association with paxillin.
9091579 1997 RAFTK, a novel member of the focal adhesion kinase family, is phosphorylated and associates with signaling molecules upon activation of mature T lymphocytes.
9020138 1997 Involvement of p130(Cas) and p105(HEF1), a novel Cas-like docking protein, in a cytoskeleton-dependent signaling pathway initiated by ligation of integrin or antigen receptor on human B cells.
8995252 1997 The related adhesion focal tyrosine kinase is tyrosine-phosphorylated after beta1-integrin stimulation in B cells and binds to p130cas.
8939945 1996 Activation of a novel calcium-dependent protein-tyrosine kinase. Correlation with c-Jun N-terminal kinase but not mitogen-activated protein kinase activation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8849729 1996 A role for Pyk2 and Src in linking G-protein-coupled receptors with MAP kinase activation.
8838818 1996 Molecular cloning and assignment of FAK2, a novel human focal adhesion kinase, to 8p11.2-p22 by nonisotopic in situ hybridization.
8798684 1996 The Ca2+-dependent lipid binding domain of P120GAP mediates protein-protein interactions with Ca2+-dependent membrane-binding proteins. Evidence for a direct interaction between annexin VI and P120GAP.
8792832 1996 Precise localization of the human gene encoding cell adhesion kinase beta (CAK beta/PYK2) to chromosome 8 at p21.1 by fluorescence in situ hybridization.
8670418 1996 Activation of Pyk2 by stress signals and coupling with JNK signaling pathway.
8497321 1993 A non-receptor tyrosine kinase that inhibits the GTPase activity of p21cdc42.
7673154 1995 Cloning and characterization of cell adhesion kinase beta, a novel protein-tyrosine kinase of the focal adhesion kinase subfamily.
7544443 1995 Protein tyrosine kinase PYK2 involved in Ca(2+)-induced regulation of ion channel and MAP kinase functions.
7529876 1995 Tyrosine phosphorylation of focal adhesion kinase at sites in the catalytic domain regulates kinase activity: a role for Src family kinases.
7499242 1995 Identification and characterization of a novel related adhesion focal tyrosine kinase (RAFTK) from megakaryocytes and brain.
1718748 1991 Molecular cloning and characterisation of a novel putative protein-serine kinase related to the cAMP-dependent and protein kinase C families.