Property Summary

NCBI Gene PubMed Count 132
PubMed Score 533.91
PubTator Score 296.11

Knowledge Summary

Patent (22,805)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 192 0.0 1.0

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.100 4.8e-06
psoriasis -1.100 5.1e-04
glioblastoma -1.100 4.9e-03
medulloblastoma, large-cell -1.400 4.4e-05
adrenocortical adenoma -1.703 2.7e-05
adrenocortical carcinoma -2.574 1.1e-14
adult high grade glioma -1.200 6.0e-04
group 4 medulloblastoma -1.100 8.7e-04

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
743265 summary 0 / 0 / 0 qHTS of PTHR Inhibitors: Summary
743266 confirmatory 308 / 6687 / 401922 qHTS of PTHR Inhibitors: Primary Screen

Gene RIF (108)

PMID Text
26562265 Data suggest affinity of ligands for binding site on PTHR1, either in GTP-binding protein-dependent or -independent conformation, alters duration of action of ligand in target cells; ligands were fragments of PTHRP/parathyroid hormone-related protein.
26303600 This Review discusses current understanding of PTHR1 modes of action and how these findings might be applied in future therapeutic agents--{REVIEW}
26047699 Disruption of beta-catenin binding to parathyroid hormone (PTH) receptor PTH1R inhibits PTH-stimulated ERK1/2 activation.
25891861 A Homozygous [Cys25]PTH(1-84) Mutation That Impairs PTH/PTHrP Receptor Activation Defines a Novel Form of Hypoparathyroidism.
25431134 We show that sustained stimulation with PTH leads to diminished potentiation of carbachol-evoked Ca2+ signals. This does not require internalization of PTH1R.
25218037 salt bridge between Arg-20 on parathyroid hormone (PTH) and Asp-137 on the PTH1 receptor is essential for full affinity.
25128082 Treatment of recipient HEK 293a cells transiently expressing PTH1R with PTH-myc CM allowed the labeling of endosomal structures positive for Rab5 and/or for beta-arrestin1.
25043296 PTHR1 signaling is important in maintaining osteosarcoma proliferation and undifferentiated state.
24870837 It is a critical physiological regulator of various biological processes, including bone and cartilage metabolism. (review)
24825834 evaluation of clinical and radiographic characteristics can heighten the specificity of ruling out suspected PTHR1 involvement in PFE patients
24300310 autosomal dominant mutations of PTH1R that cause PFE may also be associated with osteoarthritis; dose-dependent model may explain isolated PFE and osteoarthritis in absence of other known symptoms in the skeletal system.
24058597 The PTH1R gene was analyzed in six patients clinically diagnosed with primary failure of tooth eruption.
23868100 PTHR concentrations are higher in patients with renal failure; the ratio between oxidized (ox)PTH and non-oxPTH varies substantially in renal failure patients; children have the highest mean as well as maximum n-oxPTH concentrations compared to adults.
23771181 data significantly increase the number of presently known unique PFE-causing PTH1R mutations and provide a series of variants with unclear pathogenicity which will require further in vitro assaying to determine effects on protein structure and function
23604700 data indicate that, albeit the similarity in its subcellular distribution, PTH1R in PDL cells exhibits characteristics different from those in MG63 cells, pointing to the cell type specificity of this receptor
23300710 LCPUFAs, EPA and DHA, can activate PTH1R receptor at nanomolar concentrations and consequently provide a putative molecular mechanism for the action of fatty acids in bone
23297229 PTHR forms a ternary complex that includes arrestin and Gbetagamma dimer in response to PTH stimulation, which in turn causes an accelerated rate of G(S) activation and increases the steady-state level of activated G(S), leading to prolonged generation of cAMP.
23124878 beta-catenin binds to the PTHR-1 C-tail and switches the downstream signaling pathway from G(alphas)/cAMP to G(alphaq)/Ca(2+), which is a mechanism by which chondrocyte hypertrophy may be regulated through the PTH/PTHrP signal independent of canonical Wnt pathway
21898592 PTH(1-34) promotes coupled PTHR ubiquitination and deubiquitination, whereas PTH(7-34) activates only ubiquitination, thereby leading to PTHR downregulation.
21832055 Dynamic Na+-H+ exchanger regulatory factor-1 association and dissociation regulate parathyroid hormone receptor trafficking at membrane microdomains
21777186 [review] The PTH1R carboxy-terminal tail directs interactions with a plethora of binding partners, resulting in the activation of many pathways.
21756942 PTH-receptors regulate norepinephrine release in human heart and kidney
21672629 Ezrin promotes PTH1R mediated signaling via phospholipase and PIP2 depletion impedes receptor cell surface expression in HEK293 cells.
21518242 Constitutive expression of PTHrP receptor type 1 in human bone marrow stromal cells declines with age.
21445058 Study shows that binding to beta-arrestin1 prolongs rather than terminates the generation of cAMP by PTHR, and that cAMP generation correlates with the persistence of arrestin-receptor complexes on endosomes.
21404329 A novel variant of parathyroid hormone 1 receptor gene (PTH1R), R383Q, was cosegregated in the first primary failure of tooth eruption family.
21312071 Elevated levels of PTH1R expression were associated with breast cancer patients with diabetes.
20890029 Its genetic defect leads to chondrodysplasia. (review)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20656684 NHERF1 may serve as an adaptor, bringing beta-arrestin2 into close proximity to the PTHR, thereby facilitating beta-arrestin2 recruitment after receptor activation.
20654748 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20489161 Vascular smooth muscle PTH1R activity inhibits arteriosclerotic Wnt/beta-catenin signaling and reduces vascular oxidative stress, thus limiting aortic type I collagen and calcium accrual in diabetic LDLR-deficient mice.
20424473 Observational study of gene-disease association. (HuGE Navigator)
20172855 The crystal structure of the ligand-free PTH1R extracellular domain (ECD) reveals a dimer in which the C-terminal segment of both ECD protomers forms an alpha-helix that mimics PTH/PTHrP by occupying the peptide binding groove of the opposing protomer.
20152661 A PTH1R mutation is strongly associated with failure of orthodontically assisted eruption or tooth movement; specific treatments are discussed.
20139972 TGFBR2 forms an endocytic complex with PTH1R in response to PTH and regulates signalling by PTH and TGF-beta. TGFBR2 directly phosphorylates the PTH1R cytoplasmic domain, which modulates PTH-induced endocytosis of the PTH1R-TGFBR2 complex.
20080964 Agonist-regulated cleavage of the extracellular domain of parathyroid hormone receptor type 1
20060342 In both central and peripheral giant cell granulomas of the jaws, PTHR1 was abundantly expressed by type I multinucleated giant cells and mononucleated stromal cells with vesicular nuclei.
19952062 The paracrine/autocrine signaling through PTHrP/PTH1R could be important in early-stage lung adenocarcinoma progression.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19730683 Observational study of gene-disease association. (HuGE Navigator)
19727905 Observational study of gene-disease association. (HuGE Navigator)
19707467 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19674967 Results describe the structural basis for parathyroid hormone-related protein binding to the parathyroid hormone receptor, and establish a molecular model for the action of two biologically distinct ligands through a single receptor.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19369447 Mechanical stimulus alters conformation of type 1 parathyroid hormone receptor in bone cells.
19346515 Molecular structure demonstrates how amantibody discriminates between parathyroid hormones and provides information that could be used in the development of novel agonists and antagonists of a common receptor.
19190955 human ventricular cardiomyocytes express PTHrP and PTH1R
19188335 NHERF1 inhibited beta-arrestin2 binding to wtPTH1R but had no effect on beta-arrestin2 association with pdPTH1R. Such an effect may protect against PTH resistance or PTH1R down-regulation in cells harboring NHERF1.
19061984 PTHR1 loss-of-function mutations in familial, nonsyndromic primary failure of tooth eruption are reported.
18976975 Knockdown of parathyroid hormone 1 receptor (PTH1R) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18946036 the putative R(0) PTHR conformation can form highly stable complexes with certain PTH ligand analogs and thereby mediate surprisingly prolonged signaling responses in bone and/or kidney PTH target cells
18698360 In transgenic mice, signaling in osteocytes increases bone mass and the rate of bone remodeling.
18559376 PTHR1 functionally deleterious mutations have now been identified in five out 31 enchondromas from Ollier patients.
18541021 These data demonstrate that PTHrP and its receptor are up-regulated specifically during immortalization of T-lymphocytes by HTLV-1 infection and may facilitate the transformation process.
18539702 Different receptor subtype properties were used to demonstrate that residue 41 in PTH-1R, when either the native Leu or substituted by Ile or Met, can accommodate either Phe or Trp at position 23 of the ligand.
18395846 PTH/PTHrP receptor in MCF7 cells has higher binding affinity for PTHrP than PTH compared to the receptor in SaOS-2 cells
18375760 1.95-A structure of PTH bound to the MBP-PTH1R-extracellular domain fusion
18285546 Observational study of gene-disease association. (HuGE Navigator)
18280230 6 SNPs in the PTH gene and 3 SNPs each in the PTHLH, PTHR1 and PTHR2 genes were investigated in relation to bone mineral density
18280230 Observational study of gene-disease association. (HuGE Navigator)
18261460 These data indicate that PTHrP contributes to the malignancy of oral cancers downstream of EGFR signaling, and may thus provide a therapeutic target for oral cancer.
17904173 findings suggest that one of the pathways via which 1,25(OH)(2)D(3) exerts its anti-proliferative effects is through down-regulation of PTHrP expression
17885720 Observational study of gene-disease association. (HuGE Navigator)
17885720 PTHR1 polymorphisms influence bone density variation through effects on the growing skeleton.
17884816 that NHERF1 inhibits endocytosis without affecting PTH1R recycling
17872377 Results conclude that PTH and PTHrP bind similarly to the G protein-coupled PTHR conformation, PTH has a greater capacity to bind to the G protein-uncoupled conformation.
17511743 A microtubule-facilitated nuclear import pathway for PTHR is descibed.
17500070 constitutive activation of PTH/PTHrP receptor signaling in osteoblastic cells suppresses unloading-induced bone loss specifically through the regulation of osteoclastic activity.
17410535 PTHR1 over-expression may promote osteosarcoma progression by conferring a more aggressive phenotype, and forming a more favorable microenvironment
17406357 Modulation of cell adhesion is a normal physiological action of parathyroid hormone, mediated by increasing integrin gene transcription.
17321669 Coexpression of Etsl and CBP induced a synergistic activation of the parathyroid hormone-related protein P3 promoter only in the tumorigenic cell line.
17276526 Increased cell survival, migration, invasion, and Akt expression were studied in PTHR-overexpressing LoVo colon cancer cell lines.
17227205 cysteine at position 217 in plays a critical role in translocation to the cell surface and biological function of PTHR1
17200368 PTHrP induces HHM and concurrent cachectic syndromes by mechanisms other than directly modulating the leptin or hypothalamic feeding-regulated peptides
17038311 data delineate multiple PTH1R structural determinants for ERK1/2 activation and identify unique mechanism involving proline-rich motifs in receptor C terminus for reciprocal scaffolding of c-Src and beta-arrestin2 with class II G-protein-coupled receptor
16816927 PTHrP, TGF-beta1, and VEGF expression was significantly altered and indicated degenerative changes in Kashin-Beck disease cartilage
16813525 CCN2 was critically involved in osteolytic metastasis and was induced by PKA- and PKC-dependent activation of ERK1/2 signaling by PTHrP.
16508749 Observational study of gene-disease association. (HuGE Navigator)
16492667 beta-arrestin and G proteins activate parathyroid hormone receptor-stimulated ERK1/2 pathways
16369896 Observational study of gene-disease association. (HuGE Navigator)
16274647 Review. The multiple roles of PTHR1 in cell differentiation & proliferation in many organs, especially endochondral bone, and chondrodysplasias due to its mutation are reviewed.
16236727 the conformational change that switches the receptor into its active state proceeds in a sequential manner, with the first rapid binding step event preceding receptor activation by PTH(1-34)
16213899 Manumycin inhibits cell proliferation and decreases PTHrP levels in anaplastic thyroid cancer cells in vitro and in vivo and decreases the PTHrP level in the nucleus.
16029167 Cytoskeletal protein 4.1G facilitates the cell-surface localization of PTHR through its interaction with the C-terminus of the receptor, resulting in the potentiation of PTHR-mediated signal transduction.
16029167 Cytoskeletal protein 4.1G facilitates the cell-surface localization of PTHR through its interaction with the C-terminus of the receptor, resulting in the potentiation of PTHR-mediated signal transduction.[cytoskeletal protein 4.1G]
15744035 Observational study of gene-disease association. (HuGE Navigator)
15670850 PTH1R cytoplasmic tail interacts with calmodulin in a calcium-dependent manner via the basic 1-5-8-14 motif
15611080 PTH1R trafficking and G(q) (but not G(s)) signaling independently contribute to ERK1/2 activation, predominantly via transactivation of the epidermal growth factor receptor.
15609321 GSK3 and PKB/Akt have roles in the integrin-mediated regulation of PTHrP, IL-6 and IL-8 in pancreatic cancer
15523647 results indicate that the PTHR1 gene is not the culprit for enchondromatosis
15294324 Observational study of genotype prevalence. (HuGE Navigator)
15294324 haplotype frequencies and linkage disequilibrium (LD) analysis of four different polymorphisms at the PTHR1 locus
15016722 The PTH1R C terminus contains regulatory sequences that are involved in, but not required for, PTH1R internalization. The results demonstrate that receptor activation and internalization can be selectively dissociated.
14871409 factors present in uremia hemodialysis ultrafiltrate decrease PTH-stimulated cAMP generation by a mechanism that involves a decrease in the levels of PTH1R mRNA levels.
14729622 PTHrP is an essential growth factor for clear cell renal carcinoma and is a novel target for the von Hippel-Lindau tumor suppressor protein.
12947048 Binds to a specific sites of PTH-related protein.
12933685 collagenases can be a downstream effector of PTH/PTHrP receptor action in trabecular bone, but not in periosteum.
12592371 The parathyroid hormone-related protein receptor is expressed in breast cancer bone metastases and promotes autocrine proliferation in breast carcinoma cells.
12403624 The juxtamembrane region of the PTH-1 receptor interacts with parathyroid hormone (PTH) via a mechanism that involves the N-terminal portion of the ligand and residues 15-20, particularly residue 19, of PTH.
12368206 expression is preserved in the growth plate of human fetuses affected with fibroblast growth factor receptor type 3 activating mutations
12359237 vascular sites of expression of PTHrP and its cognate receptor in the rheumatoid synovium and/or in cultured rheumatoid synovial endothelial cells
12107160 These results show how specific interactions between PTH1Rc and its ligands may stabilize distinct conformational states, representing either the active G protein-coupled or a desensitized beta-arrestin-coupled receptor state.
12075354 Na(+)/H(+ ) exchanger regulatory factor 2 directs parathyroid hormone 1 receptor signalling
11932319 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11850620 mutant expression in enchondromatosis
11726668 different domains of PTHR implicated in agonist-dependent receptor internalization; the receptor's core (Asn-289 and Lys-382) appears to regulate internalization of the receptor/beta-arrestin complex toward early endocytic endosomes during endocytosis.

AA Sequence

MGTARIAPGLALLLCCPVLSSAYALVDADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWT      1 - 70
SASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNH     71 - 140
KGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSVSLASLTVAVLILA    141 - 210
YFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQAPPPPATAAAGYAG    211 - 280
CRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTVFGWGLPAVFVAVWVSVRATLANTG    281 - 350
CWDLSSGNKKWIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVH    351 - 420
YIVFMATPYTEVSGTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLALDFKRKARSG    421 - 490
SSSYSYGPMVSHTSVTNVGPRVGLGLPLSPRLLPTATTNGHPQLPGHAKPGTPALETLETTPPAMAAPKD    491 - 560
DGFLNGSCSGLDEEASGPERPPALLQEEWETVM                                         561 - 593
//

Text Mined References (137)

PMID Year Title
26562265 2016 Binding Selectivity of Abaloparatide for PTH-Type-1-Receptor Conformations and Effects on Downstream Signaling.
26303600 2015 PTH receptor-1 signalling-mechanistic insights and therapeutic prospects.
26047699 2015 Disruption of ?-catenin binding to parathyroid hormone (PTH) receptor inhibits PTH-stimulated ERK1/2 activation.
25891861 2015 A Homozygous [Cys25]PTH(1-84) Mutation That Impairs PTH/PTHrP Receptor Activation Defines a Novel Form of Hypoparathyroidism.
25431134 2015 Sustained signalling by PTH modulates IP3 accumulation and IP3 receptors through cyclic AMP junctions.
25218037 2014 A salt bridge between Arg-20 on parathyroid hormone (PTH) and Asp-137 on the PTH1 receptor is essential for full affinity.
25128082 2014 A tagged parathyroid hormone derivative as a carrier of antibody cargoes transported by the G protein coupled PTH1 receptor.
25043296 2015 Knockdown of PTHR1 in osteosarcoma cells decreases invasion and growth and increases tumor differentiation in vivo.
24870837 2014 [Role for PTHrP in bone and cartilage metabolism].
24825834 2014 Differential diagnosis of primary failure of eruption (PFE) with and without evidence of pathogenic mutations in the PTHR1 gene.
24300310 2014 Novel mutations in PTH1R associated with primary failure of eruption and osteoarthritis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24058597 2013 Identification of six novel PTH1R mutations in families with a history of primary failure of tooth eruption.
23868100 2013 Modeling of oxidized PTH (oxPTH) and non-oxidized PTH (n-oxPTH) receptor binding and relationship of oxidized to non-oxidized PTH in children with chronic renal failure, adult patients on hemodialysis and kidney transplant recipients.
23771181 2014 Expanding the spectrum of PTH1R mutations in patients with primary failure of tooth eruption.
23604700 2014 Functional characterization of the parathyroid hormone 1 receptor in human periodontal ligament cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23300710 2012 PTH1 receptor is involved in mediating cellular response to long-chain polyunsaturated fatty acids.
23297229 2013 Noncanonical GPCR signaling arising from a PTH receptor-arrestin-G?? complex.
23124878 2013 ?-catenin regulates parathyroid hormone/parathyroid hormone-related protein receptor signals and chondrocyte hypertrophy through binding to the intracellular C-terminal region of the receptor.
21898592 2011 Ubiquitination-deubiquitination balance dictates ligand-stimulated PTHR sorting.
21832055 2011 Dynamic Na+-H+ exchanger regulatory factor-1 association and dissociation regulate parathyroid hormone receptor trafficking at membrane microdomains.
21777186 2012 The parathyroid hormone receptorsome and the potential for therapeutic intervention.
21756942 2011 PTH-receptors regulate norepinephrine release in human heart and kidney.
21672629 2011 Apical membrane segregation of phosphatidylinositol-4,5-bisphosphate influences parathyroid hormone 1 receptor compartmental signaling and localization via direct regulation of ezrin in LLC-PK1 cells.
21518242 2011 Effects of age on parathyroid hormone signaling in human marrow stromal cells.
21445058 2011 Retromer terminates the generation of cAMP by internalized PTH receptors.
21404329 2011 Exome resequencing combined with linkage analysis identifies novel PTH1R variants in primary failure of tooth eruption in Japanese.
21312071 2012 Type 1 receptor parathyroid hormone (PTH1R) influences breast cancer cell proliferation and apoptosis induced by high levels of glucose.
20890029 2010 [Cytokines in bone diseases. Genetic defects of PTH/PTHrP receptor in chondrodysplasia].
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20656684 2010 Formation of a ternary complex among NHERF1, beta-arrestin, and parathyroid hormone receptor.
20654748 2010 High-density polymorphisms analysis of 23 candidate genes for association with bone mineral density.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20489161 2010 Activation of vascular smooth muscle parathyroid hormone receptor inhibits Wnt/beta-catenin signaling and aortic fibrosis in diabetic arteriosclerosis.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20172855 2010 Dimeric arrangement of the parathyroid hormone receptor and a structural mechanism for ligand-induced dissociation.
20152661 2010 Primary failure of eruption and PTH1R: the importance of a genetic diagnosis for orthodontic treatment planning.
20139972 2010 TGF-beta type II receptor phosphorylates PTH receptor to integrate bone remodelling signalling.
20080964 2010 Agonist-regulated cleavage of the extracellular domain of parathyroid hormone receptor type 1.
20060342 2010 Parathyroid hormone-related peptide (PTHrP), parathyroid hormone/parathyroid hormone-related peptide receptor 1 (PTHR1), and MSX1 protein are expressed in central and peripheral giant cell granulomas of the jaws.
19952062 2010 Parathyroid hormone-related peptide and parathyroid hormone-related peptide receptor type 1 expression in human lung adenocarcinoma.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19727905 2010 Common variants in FLNB/CRTAP, not ARHGEF3 at 3p, are associated with osteoporosis in southern Chinese women.
19707467 2008 Etiology of hypercoagulable state in women with recurrent fetal loss without other causes of miscarriage from Southern Italy: new clinical target for antithrombotic therapy.
19674967 2009 Structural basis for parathyroid hormone-related protein binding to the parathyroid hormone receptor and design of conformation-selective peptides.
19608645 2009 The parathyroid hormone 1 receptor directly binds to the FERM domain of ezrin, an interaction that supports apical receptor localization and signaling in LLC-PK1 cells.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19369447 2009 Mechanical stimulus alters conformation of type 1 parathyroid hormone receptor in bone cells.
19346515 2009 Structural basis for antibody discrimination between two hormones that recognize the parathyroid hormone receptor.
19190955 2009 Ischemic injury activates PTHrP and PTH1R expression in human ventricular cardiomyocytes.
19188335 2009 NHERF1 regulates parathyroid hormone receptor desensitization: interference with beta-arrestin binding.
19061984 2008 PTHR1 loss-of-function mutations in familial, nonsyndromic primary failure of tooth eruption.
18946036 2008 Prolonged signaling at the parathyroid hormone receptor by peptide ligands targeted to a specific receptor conformation.
18698360 2008 Control of bone mass and remodeling by PTH receptor signaling in osteocytes.
18611381 2008 Structure of the parathyroid hormone receptor C terminus bound to the G-protein dimer Gbeta1gamma2.
18559376 2008 PTHR1 mutations associated with Ollier disease result in receptor loss of function.
18541021 2008 Expression of parathyroid hormone-related protein during immortalization of human peripheral blood mononuclear cells by HTLV-1: implications for transformation.
18539702 2008 Ligand-receptor interactions at the parathyroid hormone receptors: subtype binding selectivity is mediated via an interaction between residue 23 on the ligand and residue 41 on the receptor.
18395846 2008 Quantitative comparison of PTH1R in breast cancer MCF7 and osteosarcoma SaOS-2 cell lines.
18375760 2008 Molecular recognition of parathyroid hormone by its G protein-coupled receptor.
18285546 2008 A PAI-1 (SERPINE1) polymorphism predicts osteonecrosis in children with acute lymphoblastic leukemia: a report from the Children's Oncology Group.
18280230 2008 Genetic variation in the PTH pathway and bone phenotypes in elderly women: evaluation of PTH, PTHLH, PTHR1 and PTHR2 genes.
18261460 2008 PTHrP promotes malignancy of human oral cancer cell downstream of the EGFR signaling.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17904173 2007 PTHrP contributes to the anti-proliferative and integrin alpha6beta4-regulating effects of 1,25-dihydroxyvitamin D(3).
17885720 2007 PTHR1 polymorphisms influence BMD variation through effects on the growing skeleton.
17884816 2007 NHERF1 regulates parathyroid hormone receptor membrane retention without affecting recycling.
17872377 2008 Altered selectivity of parathyroid hormone (PTH) and PTH-related protein (PTHrP) for distinct conformations of the PTH/PTHrP receptor.
17511743 2007 A microtubule-facilitated nuclear import pathway for cancer regulatory proteins.
17500070 2007 Constitutively active parathyroid hormone receptor signaling in cells in osteoblastic lineage suppresses mechanical unloading-induced bone resorption.
17410535 2007 Over-expression of parathyroid hormone Type 1 receptor confers an aggressive phenotype in osteosarcoma.
17406357 2007 PTHrP increases transcriptional activity of the integrin subunit alpha5.
17321669 2007 PTHrP P3 promoter activity in breast cancer cell lines: role of Ets1 and CBP (CREB binding protein).
17276526 2007 Increased cell survival, migration, invasion, and Akt expression in PTHrP-overexpressing LoVo colon cancer cell lines.
17227205 2007 Cysteine at position 217 in the intracellular loop 1 plays a critical role in human PTH receptor type 1 membrane translocation and function.
17200368 2007 Parathyroid hormone-related protein induces cachectic syndromes without directly modulating the expression of hypothalamic feeding-regulating peptides.
17038311 2006 Proline-rich motifs in the parathyroid hormone (PTH)/PTH-related protein receptor C terminus mediate scaffolding of c-Src with beta-arrestin2 for ERK1/2 activation.
16816927 2006 Abnormal expression of Col X, PTHrP, TGF-beta, bFGF, and VEGF in cartilage with Kashin-Beck disease.
16813525 2006 Pathogenic role of connective tissue growth factor (CTGF/CCN2) in osteolytic metastasis of breast cancer.
16508749 2006 A functional polymorphism in the PTHR1 promoter region is associated with adult height and BMD measured at the femoral neck in a large cohort of young caucasian women.
16492667 2006 Distinct beta-arrestin- and G protein-dependent pathways for parathyroid hormone receptor-stimulated ERK1/2 activation.
16369896 2006 Tests of linkage and association of PTH/PTHrP receptor type 1 gene with bone mineral density and height in Caucasians.
16274647 2005 [Hereditary skeletal dysplasias and FGFR3 and PTHR1 signaling pathways].
16236727 2005 Turn-on switch in parathyroid hormone receptor by a two-step parathyroid hormone binding mechanism.
16213899 2005 Modulation of parathyroid hormone-related protein levels (PTHrP) in anaplastic thyroid cancer.
16099817 2006 A docking site for G protein ?? subunits on the parathyroid hormone 1 receptor supports signaling through multiple pathways.
16029167 2005 Increase in cell-surface localization of parathyroid hormone receptor by cytoskeletal protein 4.1G.
15744035 2005 A survey of haplotype variants at several disease candidate genes: the importance of rare variants for complex diseases.
15670850 2005 Calmodulin interacts with the cytoplasmic tails of the parathyroid hormone 1 receptor and a sub-set of class b G-protein coupled receptors.
15611080 2005 Parathyroid hormone receptor trafficking contributes to the activation of extracellular signal-regulated kinases but is not required for regulation of cAMP signaling.
15609321 2005 GSK3 and PKB/Akt are associated with integrin-mediated regulation of PTHrP, IL-6 and IL-8 expression in FG pancreatic cancer cells.
15525660 2005 Recessive mutations in PTHR1 cause contrasting skeletal dysplasias in Eiken and Blomstrand syndromes.
15523647 2004 Enchondromatosis (Ollier disease, Maffucci syndrome) is not caused by the PTHR1 mutation p.R150C.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15294324 2004 Haplotype frequencies and linkage disequilibrium analysis of four frequent polymorphisms at the PTH/PTH-related peptide receptor gene locus.
15240651 2004 A form of Jansen's metaphyseal chondrodysplasia with limited metabolic and skeletal abnormalities is caused by a novel activating parathyroid hormone (PTH)/PTH-related peptide receptor mutation.
15016722 2004 Ligand-selective dissociation of activation and internalization of the parathyroid hormone (PTH) receptor: conditional efficacy of PTH peptide fragments.
14871409 2004 Regulation of PTH1 receptor expression by uremic ultrafiltrate in UMR 106-01 osteoblast-like cells.
14729622 2004 Parathyroid hormone-related protein is an essential growth factor for human clear cell renal carcinoma and a target for the von Hippel-Lindau tumor suppressor gene.
12947048 2003 Identification of a contact site for residue 19 of parathyroid hormone (PTH) and PTH-related protein analogs in transmembrane domain two of the type 1 PTH receptor.
12933685 2003 Collagenase cleavage of type I collagen is essential for both basal and parathyroid hormone (PTH)/PTH-related peptide receptor-induced osteoclast activation and has differential effects on discrete bone compartments.
12595070 2003 Interaction of the parathyroid hormone receptor with the 14-3-3 protein.
12592371 2003 The parathyroid hormone-related protein receptor is expressed in breast cancer bone metastases and promotes autocrine proliferation in breast carcinoma cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12403624 2002 Residue 19 of the parathyroid hormone (PTH) modulates ligand interaction with the juxtamembrane region of the PTH-1 receptor.
12368206 2002 Parathyroid hormone receptor type 1/Indian hedgehog expression is preserved in the growth plate of human fetuses affected with fibroblast growth factor receptor type 3 activating mutations.
12359237 2002 Expression of PTHrP and its cognate receptor in the rheumatoid synovial microcirculation.
12220636 2002 The COOH-terminus of parathyroid hormone-related protein (PTHrP) interacts with beta-arrestin 1B.
12107160 2002 Selective ligand-induced stabilization of active and desensitized parathyroid hormone type 1 receptor conformations.
12075354 2002 Na(+)/H(+ ) exchanger regulatory factor 2 directs parathyroid hormone 1 receptor signalling.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
11932319 2002 Association between AAAG repeat polymorphism in the P3 promoter of the human parathyroid hormone (PTH)/PTH-related peptide receptor gene and adult height, urinary pyridinoline excretion, and promoter activity.
11850620 2002 A mutant PTH/PTHrP type I receptor in enchondromatosis.
11726668 2002 Internalization determinants of the parathyroid hormone receptor differentially regulate beta-arrestin/receptor association.
10913300 2000 The N-terminal fragment of human parathyroid hormone receptor 1 constitutes a hormone binding domain and reveals a distinct disulfide pattern.
10854575 2000 Parathyroid hormone-related protein is expressed by transformed and fetal human astrocytes and inhibits cell proliferation.
10770955 2000 Temperature-sensitive differential affinity of TRAIL for its receptors. DR5 is the highest affinity receptor.
10709993 2000 Nuclear localization of the type 1 parathyroid hormone/parathyroid hormone-related peptide receptor in MC3T3-E1 cells: association with serum-induced cell proliferation.
10523019 1999 A frame-shift mutation in the type I parathyroid hormone (PTH)/PTH-related peptide receptor causing Blomstrand lethal osteochondrodysplasia.
10487664 1999 A novel parathyroid hormone (PTH)/PTH-related peptide receptor mutation in Jansen's metaphyseal chondrodysplasia.
9927325 1999 Human osteoclast-like cells are formed from peripheral blood mononuclear cells in a coculture with SaOS-2 cells transfected with the parathyroid hormone (PTH)/PTH-related protein receptor gene.
9817594 1998 Arginine 186 in the extracellular N-terminal region of the human parathyroid hormone 1 receptor is essential for contact with position 13 of the hormone.
9745456 1998 A homozygous inactivating mutation in the parathyroid hormone/parathyroid hormone-related peptide receptor causing Blomstrand chondrodysplasia.
9737850 1998 Binding domain of human parathyroid hormone receptor: from conformation to function.
9649554 1998 Absence of functional receptors for parathyroid hormone and parathyroid hormone-related peptide in Blomstrand chondrodysplasia.
9178745 1997 Constitutive activation of the cyclic adenosine 3',5'-monophosphate signaling pathway by parathyroid hormone (PTH)/PTH-related peptide receptors mutated at the two loci for Jansen's metaphyseal chondrodysplasia.
9108031 1997 Direct mapping of an agonist-binding domain within the parathyroid hormone/parathyroid hormone-related protein receptor by photoaffinity crosslinking.
8703170 1996 Constitutively activated receptors for parathyroid hormone and parathyroid hormone-related peptide in Jansen's metaphyseal chondrodysplasia.
8397094 1993 Cloning and functional expression of a human parathyroid hormone receptor.
8386612 1993 Identical complementary deoxyribonucleic acids encode a human renal and bone parathyroid hormone (PTH)/PTH-related peptide receptor.
8197183 1994 Molecular cloning of the gene encoding the mouse parathyroid hormone/parathyroid hormone-related peptide receptor.
8020952 1994 Cloning of a parathyroid hormone/parathyroid hormone-related peptide receptor (PTHR) cDNA from a rat osteosarcoma (UMR 106) cell line: chromosomal assignment of the gene in the human, mouse, and rat genomes.
7745008 1995 Pseudohypoparathyroidism type Ib is not caused by mutations in the coding exons of the human parathyroid hormone (PTH)/PTH-related peptide receptor gene.
7701349 1995 A constitutively active mutant PTH-PTHrP receptor in Jansen-type metaphyseal chondrodysplasia.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.