Property Summary

NCBI Gene PubMed Count 1,999
PubMed Score 12504.51
PubTator Score 7000.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Colitis 52 4.913 2.5
Coronary artery disease 253 4.318 2.2
Hypertension 372 4.274 2.1
Atherosclerosis 276 4.144 2.1
Endometriosis 521 3.984 2.0
diabetes mellitus 1683 3.818 1.9
Obesity 655 3.162 1.6
Adenocarcinoma 116 0.0 0.0
Adenocarcinoma Of Esophagus 14 0.0 0.0
Adenomatous Polyposis Coli 16 0.0 0.0
Adrenal Gland Neoplasms 11 0.0 0.0
Albuminuria 20 0.0 0.0
Amyotrophic lateral sclerosis 437 0.0 0.0
Aortic Aneurysm, Abdominal 6 0.0 0.0
Arrhythmias, Cardiac 17 0.0 0.0
Arthritis, Rheumatoid 169 0.0 0.0
Asphyxia neonatorum 11 0.0 0.0
Asthma, Aspirin-Induced 13 0.0 0.0
Asthma, Occupational 10 0.0 0.0
Autistic Disorder 358 0.0 0.0
Barrett Esophagus 16 0.0 0.0
Bone neoplasms 6 0.0 0.0
Brain Injuries 63 0.0 0.0
Brain Ischemia 107 0.0 0.0
Breast Neoplasms 423 0.0 0.0
Burns 9 0.0 0.0
Cachexia 50 0.0 0.0
Carcinoma 11192 0.0 1.0
Carcinoma in Situ 1 0.0 0.0
Carcinoma, Ductal, Breast 11 0.0 0.0
Carcinoma, Hepatocellular 217 0.0 0.0
Carcinoma, Renal Cell 121 0.0 0.0
Carcinoma, Squamous Cell 107 0.0 0.0
Carcinoma, Transitional Cell 31 0.0 0.0
Carcinoma, squamous cell of head and neck 30 0.0 0.0
Cardiomyopathies 109 0.0 0.0
Cardiovascular Diseases 57 0.0 0.0
Chemical and Drug Induced Liver Injury 188 0.0 0.0
Cholangiocarcinoma 35 0.0 0.0
Cognition Disorders 30 0.0 0.0
Colonic Neoplasms 133 0.0 0.0
Colorectal Neoplasms 235 0.0 0.0
Depressive disorder 401 0.0 0.0
Diabetes Mellitus, Experimental 101 0.0 0.0
Drug-Related Side Effects and Adverse Reactions 61 0.0 0.0
Duodenal ulcer 20 0.0 0.0
Edema 80 0.0 0.0
Esophageal Neoplasms 68 0.0 0.0
Esophageal Squamous Cell Carcinoma 72 0.0 0.0
Fibrosis 43 0.0 0.0
Gastroesophageal Reflux 4 0.0 0.0
Glaucoma, Open-Angle 11 0.0 0.0
Glioma 73 0.0 0.0
Graves Ophthalmopathy 2 0.0 0.0
Heart failure 157 0.0 0.0
Hydronephrosis 87 0.0 0.0
Hyperalgesia 80 0.0 0.0
Hyperemia 12 0.0 0.0
Hyperglycemia 134 0.0 0.0
Hyperplasia 26 0.0 0.0
Inflammation 116 0.0 0.0
Inflammatory Bowel Diseases 35 0.0 0.0
Intestinal Polyps 5 0.0 0.0
Kidney Diseases 110 0.0 0.0
Kidney Failure, Chronic 45 0.0 0.0
Kidney Neoplasms 36 0.0 0.0
Leiomyosarcoma 23 0.0 0.0
Leukemia, Lymphocytic, Chronic, B-Cell 33 0.0 0.0
Leukoplakia, Oral 20 0.0 0.0
Liver Cirrhosis, Experimental 733 0.0 0.0
Lung diseases 47 0.0 0.0
Lupus Erythematosus, Systemic 66 0.0 0.0
Lymphoma, B-Cell 6 0.0 0.0
Melanoma 689 0.0 0.0
Mouth Diseases 11 0.0 0.0
Mouth Neoplasms 54 0.0 0.0
Neoplasm Metastasis 160 0.0 0.0
Neoplasm Recurrence, Local 35 0.0 0.0
Neoplasms 57 0.0 0.0
Nervous System Diseases 50 0.0 0.0
Neurogenic Inflammation 11 0.0 0.0
Oral Submucous Fibrosis 16 0.0 0.0
Pancreatic Neoplasms 82 0.0 0.0
Pancreatitis 118 0.0 0.0
Papilloma 44 0.0 0.0
Pericardial effusion 14 0.0 0.0
Precancerous Conditions 78 0.0 0.0
Premature Birth 76 0.0 0.0
Prostatic Neoplasms 472 0.0 0.0
Proteinuria 143 0.0 0.0
Puberty, Precocious 5 0.0 0.0
Reperfusion Injury 84 0.0 0.0
Seizures 584 0.0 0.0
Skin Diseases 66 0.0 0.0
Skin Neoplasms 67 0.0 0.0
Status Epilepticus 96 0.0 0.0
Stomach Neoplasms 287 0.0 0.0
Stomach Ulcer 17 0.0 0.0
Stroke 32 0.0 0.0
Thrombosis 41 0.0 0.0
Thyroid Neoplasms 34 0.0 0.0
Tongue Neoplasms 8 0.0 0.0
Urinary Bladder Neck Obstruction 1 0.0 0.0
Urinary Bladder Neoplasms 108 0.0 0.0
Disease Target Count Z-score Confidence
Schizophrenia 1136 0.0 1.4

Expression

  Differential Expression (32)

Disease log2 FC p
acute myeloid leukemia 1.800 3.9e-02
adrenocortical adenoma -1.952 1.8e-04
adrenocortical carcinoma -1.943 5.6e-03
aldosterone-producing adenoma -1.469 1.8e-02
astrocytoma -1.400 1.6e-07
atypical teratoid / rhabdoid tumor -1.800 4.8e-04
Bipolar Disorder 2.371 3.9e-02
Breast cancer -3.000 1.6e-26
breast carcinoma -1.600 8.5e-13
cystic fibrosis 1.477 6.1e-05
glioblastoma -1.100 4.2e-02
Hydrolethalus syndrome 2.229 2.1e-02
interstitial cystitis 2.700 1.6e-02
intraductal papillary-mucinous adenoma (... -1.600 1.1e-02
lung adenocarcinoma -1.841 5.5e-03
lung cancer -1.800 2.8e-04
lung carcinoma -3.400 7.2e-21
malignant mesothelioma -7.800 3.1e-10
medulloblastoma -1.800 2.3e-03
medulloblastoma, large-cell -2.100 2.6e-02
nasopharyngeal carcinoma 2.300 7.7e-04
non-small cell lung cancer -1.775 4.5e-07
oligodendroglioma -2.100 3.9e-02
ovarian cancer 1.800 1.9e-02
pancreatic cancer 1.600 1.4e-03
pediatric high grade glioma -1.500 3.0e-02
posterior fossa group B ependymoma -1.500 2.4e-03
primitive neuroectodermal tumor -2.200 3.7e-03
psoriasis -1.100 2.7e-02
remitted schizophrenia patient 1.100 4.5e-02
tuberculosis -2.500 1.8e-04
ulcerative colitis 3.900 1.1e-04

 GWAS Trait (1)

Gene RIF (2106)

AA Sequence

MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPT      1 - 70
PNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPP     71 - 140
VPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGL    141 - 210
GHGVDLNHIYGETLARQRKLRLFKDGKMKYQIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGL    211 - 280
VPGLMMYATIWLREHNRVCDVLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPE    281 - 350
LLFNKQFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV    351 - 420
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEALYGDIDAVELY    421 - 490
PALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKG    491 - 560
CPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKERSTEL                              561 - 604
//

Text Mined References (2002)

PMID Year Title