Property Summary

NCBI Gene PubMed Count 81
PubMed Score 316.95
PubTator Score 138.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
malignant mesothelioma -8.600 3.0e-10
psoriasis -1.500 1.5e-02
osteosarcoma 1.477 5.3e-04
cystic fibrosis -1.458 8.8e-04
Atopic dermatitis -1.600 3.0e-03
adrenocortical carcinoma -1.239 2.3e-02
primary pancreatic ductal adenocarcinoma 2.591 1.1e-03
non-small cell lung cancer -1.226 2.2e-05
intraductal papillary-mucinous adenoma (... -2.500 1.9e-03
intraductal papillary-mucinous carcinoma... -3.800 3.8e-05
intraductal papillary-mucinous neoplasm ... -3.600 1.3e-03
colon cancer -1.200 4.8e-03
lung cancer -1.100 2.3e-02
lung adenocarcinoma -1.708 2.1e-07
atypical teratoid/rhabdoid tumor 1.200 3.8e-03
group 3 medulloblastoma -1.300 4.9e-02
Breast cancer -1.200 4.6e-02
lung carcinoma -2.300 2.1e-16
breast carcinoma -1.100 2.6e-09
gastric carcinoma 2.000 2.7e-02
ductal carcinoma in situ -1.400 4.0e-02
invasive ductal carcinoma -2.600 4.0e-03
ovarian cancer -5.500 1.0e-19
Gaucher disease type 3 -1.500 2.5e-02
pancreatic cancer 2.800 1.0e-04

 GWAS Trait (1)

Gene RIF (70)

PMID Text
26130461 In examining the tumor suppressor PTGIS as a potential biomarker for treatment with either 5-Aza-dC or TSA, 5-Aza-dC effectively stabilized cell cycling, restricted genetic instability and derepressed PTGIS expression
25623425 Based on the predicted crystal structure of CYP8A1( *)5 using the Molecular Operating Environment platform, the distance from CYP8A1 Cys441 to the heme was altered with a significantly changed binding free energy for the mutant protein.
25256272 results indicate that PGIS expression was associated with radiotherapy efficiency
24605778 In a case-control study unaffected carriers of a BMPR2 mutation, linked to pulmonary artery hypertension (PAH), were most often found to have prostacyclin synthase promoter sequence variants, which were thought to protect against PAH.
24225501 Type-2 diabetes is associated with higher COX-2 expression, but lower eNOS and PGIS expression in subcutaneous arteries.
23807031 These findings suggest that PGIS is induced by hypoxia and regulates the expression of VEGF in fibroblasts.
22219064 High PTGIS expression is associated with colorectal cancer hepatic metastasis.
22109564 Overexpression of PTGIS is associated with liver metastasis in colon cancer.
22072641 The CC genotype of C1117A polymorphism is associated with higher risk of LM-CAD
21052031 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20452033 downregulated in endometriosis tissues
20357747 Review: PGI2 function depends on the different alleles of the PTGIS gene and that they may influence the risk of cardiovascular disease.
20348234 diabetes preferentially increases PGIS nitration that is associated with excessive vascular inflammation in atherosclerotic carotid arteries from patients with type 2 diabetes
20346360 Observational study of gene-disease association. (HuGE Navigator)
20159982 PGIS overexpression apparently protects insulin-producing cells against cytokine toxicity via suppression of endoplasmic reticulum and mitochondrial stress-mediated cell death pathways
19913121 Observational study of gene-disease association. (HuGE Navigator)
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19719985 In the Uigur population CC genotype of rs5629 and the C-T-T haplotype of prostacyclin synthase gene are associated with myocardial infarction but the A-C-T haplotype of prostacyclin synthase gene might be a protective factor.
19719985 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19534932 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19327107 The CC genotype of CYP8A1 is associated with myocardial infarction(MI), respectively.
19327107 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19276290 Observational study of gene-disease association. (HuGE Navigator)
19265782 rs237484 is in proximity to the potassium voltage gate channel gene (KCNB1) and close to the prostaglandin I2 (prostacyclin) synthase gene (PTGIS).
19265782 Observational study of gene-disease association. (HuGE Navigator)
19187034 Characterization of the recombinant PGIS intermediates is reported in reactions with other peroxides, peracetic acid, and iodosylbenzene, providing a mechanistic model of a peroxidase reaction catalyzed by the class III cytochromes P450.
19147528 MI is associated with the CC genotype of rs5629 in the human CYP8A1 gene. The A-C-T haplotype appears to be a useful genetic marker and the C-T-T haplotype might be a protective factor of MI in Chinese people.
19147528 Observational study of gene-disease association. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
19065539 The CC genotype and C allele of the prostacyclin synthase gene might be a risk factor of MI in Uigur population in Xinjiang.
19065539 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
19046748 PTGIS genetic variation is associated with incident myocardial infarction. Carriers of rs20417C allele may derive greater benefits from aspirin use.
19046748 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19040046 Populations with both COX-2 -765GG and PGIS CC genotypes were more at risk for myocardial infarction.
18814254 Observational study of gene-disease association. (HuGE Navigator)
18081314 These studies have provided the structural information for the interaction of the PGIS with its substrate mimic.
17635855 An intramuscular injection of AAV-PGIS prevents monocrotaline-pulmonary arterial hypertension in rats and provides a new therapeutic alternative for preventing pulmonary arterial hypertension in humans.
17374734 PGIS promoter haplotype can play an important role in the predisposition for lung cancer and CpG methylation provides an epigenetic mechanism for the down-regulated PGIS expression.
17303142 Adenovirus PGIS gene transfer reduced PPAR delta expression and inhibited neointimal formation after balloon injury in accordance with the reduction in the phosphorylation of p38 MAPK
17221326 In vitro shear stress can promote PGI(2 )secretion by human endothelial progenitor cells.
17210107 Dengue virus could promote the expression of PGIS mRNA in HUVEC and increase the level of PGI(2), which may increase the vascular permeability.
17070428 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16537708 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16406803 PGIS has a typical low-spin heme with a hydrophobic active site.
16081819 The two major genetic loci Pgis1 and Pgis2 of murine spondylitis are homologous to chromosome regions in human genome, which control ankylosing spondylitis in human patients.
16007128 Epigenetic inactivation of the PTGIS gene is a recurrent alteration in colorectal carcinogenesis
15182267 Observational study of gene-disease association. (HuGE Navigator)
15182267 results suggest specific VNTR polymorphism in the 5'-upstream promoter region of the PGIS gene regulated prostacyclin production, but did not seem to be associated with development of CTEPH (chronic thromboembolic pulmonary hypertension)
12924623 Observational study of gene-disease association. (HuGE Navigator)
12924623 We successfully identified haplotypes of the PGIS gene, and these haplotypes were not associated with essential hypertension.
12751759 splicing mutation found in hypertension
12741817 residue(s) within helix F/G loop of PGIS may be involved in forming the substrate access channel and located in a position that influences the membrane-bound PGIS catalytic function
12664597 effect of overexpression of this enzyme transfected into vascular smooth muscle cells in rats
12428676 Observational study of genotype prevalence. (HuGE Navigator)
12414902 gestational age decrease in the inhibitory prostaglandin I2 synthase is consistent with lessening of its influence in myometrium at the time of labor
12414894 Cyclic mechanical stretch augmented prostacyclin synthase promoter activity, via activation of activator protein-1 site, and prostacyclin synthase mRNA and protein expression in cultured human myometrial cells
12372404 the PGIS gene has a splicing mutation in familial hypertension
12213900 the fallopian tube expresses both COX isoforms and PGIS
12193162 NMR and circular dichroism solution structure of microsomal PGIS
12040339 Observational study of gene-disease association. (HuGE Navigator)
11924728 Observational study of gene-disease association. (HuGE Navigator)
11924728 Association study between a novel single nucleotide polymorphism of the promoter region of the prostacyclin synthase gene and essential hypertension.
11368458 Observational study of gene-disease association. (HuGE Navigator)
11130769 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAWAALLGLLAALLLLLLLSRRRTRRPGEPPLDLGSIPWLGYALDFGKDAASFLTRMKEKHGDIFTILVG      1 - 70
GRYVTVLLDPHSYDAVVWEPRTRLDFHAYAIFLMERIFDVQLPHYSPSDEKARMKLTLLHRELQALTEAM     71 - 140
YTNLHAVLLGDATEAGSGWHEMGLLDFSYSFLLRAGYLTLYGIEALPRTHESQAQDRVHSADVFHTFRQL    141 - 210
DRLLPKLARGSLSVGDKDHMCSVKSRLWKLLSPARLARRAHRSKWLESYLLHLEEMGVSEEMQARALVLQ    211 - 280
LWATQGNMGPAAFWLLLFLLKNPEALAAVRGELESILWQAEQPVSQTTTLPQKVLDSTPVLDSVLSESLR    281 - 350
LTAAPFITREVVVDLAMPMADGREFNLRRGDRLLLFPFLSPQRDPEIYTDPEVFKYNRFLNPDGSEKKDF    351 - 420
YKDGKRLKNYNMPWGAGHNHCLGRSYAVNSIKQFVFLVLVHLDLELINADVEIPEFDLSRYGFGLMQPEH    421 - 490
DVPVRYRIRP                                                                491 - 500
//

Text Mined References (81)

PMID Year Title
26130461 2015 Evaluation of Epigenetic Drug Targeting of Heterogenous Tumor Cell Fractions Using Potential Biomarkers of Response in Ovarian Cancer.
25623425 2015 Analysis of genetic polymorphism and biochemical characterization of a functionally decreased variant in prostacyclin synthase gene (CYP8A1) in humans.
25256272 2015 Prostacyclin-synthase expression in head and neck carcinoma patients and its prognostic value in the response to radiotherapy.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24605778 2014 Functional prostacyclin synthase promoter polymorphisms. Impact in pulmonary arterial hypertension.
24225501 2013 Reduced expression of prostacyclin synthase and nitric oxide synthase in subcutaneous arteries of type 2 diabetic patients.
23807031 2013 VEGF expression is augmented by hypoxia?induced PGIS in human fibroblasts.
22219064 2012 Combination of haptoglobin and osteopontin could predict colorectal cancer hepatic metastasis.
22109564 2012 Overexpression of PTGIS could predict liver metastasis and is correlated with poor prognosis in colon cancer patients.
22072641 2012 CYP8A1 gene polymorphisms and left main coronary artery disease.
21296955 2011 Hypoxia upregulates PGI-synthase and increases PGI? release in human vascular cells exposed to inflammatory stimuli.
21052031 2011 Identification of genetic factors associated with susceptibility to angiotensin-converting enzyme inhibitors-induced cough.
21035466 2011 Inducible COX-2 dominates over COX-1 in prostacyclin biosynthesis: mechanisms of COX-2 inhibitor risk to heart disease.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20452033 2010 DNA microarray analysis in a mouse model for endometriosis and validation of candidate factors with human adenomyosis.
20357747 2010 Genetic polymorphisms of prostacyclin synthase gene and cardiovascular disease.
20348234 2010 Enhanced tyrosine nitration of prostacyclin synthase is associated with increased inflammation in atherosclerotic carotid arteries from type 2 diabetic patients.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20159982 2010 Protection against cytokine toxicity through endoplasmic reticulum and mitochondrial stress prevention by prostacyclin synthase overexpression in insulin-producing cells.
20122998 2010 The role of prostacyclin synthase and thromboxane synthase signaling in the development and progression of cancer.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19719985 2009 [Haplotypes analysis of the prostacyclin synthase gene and myocardial infarction in Uigur population].
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19534932 2009 [Association of GLu461ALa polymorphism of prostacyclin synthase gene with myocardial infarction in Uigur population].
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19327107 2009 Association of polymorphisms of PTGS2 and CYP8A1 with myocardial infarction.
19276290 2009 Common polymorphisms in the prostaglandin pathway genes and their association with breast cancer susceptibility and survival.
19265782 2009 A quantitative trait locus for SBP maps near KCNB1 and PTGIS in a population isolate.
19187034 2009 Characterization of the peroxidase mechanism upon reaction of prostacyclin synthase with peracetic acid. Identification of a tyrosyl radical intermediate.
19147528 2009 Haplotype analysis of the CYP8A1 gene associated with myocardial infarction.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19065539 2008 [Association of polymorphism of the prostacyclin synthase gene with myocardial infarction in Uigur population of Xinjiang].
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
19046748 2009 Variation in eicosanoid genes, non-fatal myocardial infarction and ischemic stroke.
19040046 2008 [Study on the association of cyclooxygenase-2 -765g>C and prostacyclin synthase C1117A polymorphisms and the risk of myocardial infarction in Uigur population of Xinjiang, China].
18814254 2008 Functional polymorphism of the promoter region of the prostacyclin synthase gene and severity of RSV infection in hospitalized children.
18081314 2008 Characterization of the substrate mimic bound to engineered prostacyclin synthase in solution using high-resolution NMR spectroscopy and mutagenesis: implication of the molecular mechanism in biosynthesis of prostacyclin.
17635855 2007 Adenoassociated virus-mediated prostacyclin synthase expression prevents pulmonary arterial hypertension in rats.
17374734 2007 Genetic and epigenetic regulation of the human prostacyclin synthase promoter in lung cancer cell lines.
17303142 2007 Prostacyclin synthase gene transfer inhibits neointimal formation by suppressing PPAR delta expression.
17221326 2007 In vitro shear stress modulates antithrombogenic potentials of human endothelial progenitor cells.
17210107 2007 [Effects of Dengue virus infection on PGIS expression and PGI2 secretion of human vascular endothelial cells].
17070428 2006 Assessment of the genetic component of hypertension.
17020766 2006 Crystal structure of the human prostacyclin synthase.
16537708 2006 Prostacyclin synthase and arachidonate 5-lipoxygenase polymorphisms and risk of colorectal polyps.
16406803 2005 Characterization of heme environment and mechanism of peroxide bond cleavage in human prostacyclin synthase.
16081819 2005 Two major interacting chromosome loci control disease susceptibility in murine model of spondyloarthropathy.
16007128 2005 Hypermethylation of the prostacyclin synthase (PTGIS) promoter is a frequent event in colorectal cancer and associated with aneuploidy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15182267 2004 Polymorphism of the promoter region of prostacyclin synthase gene in chronic thromboembolic pulmonary hypertension.
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
15115769 2004 Purification and characterization of recombinant human prostacyclin synthase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12924623 2003 Haplotype analysis of the prostacyclin synthase gene and essential hypertension.
12751759 2003 Splicing mutation of the prostacyclin synthase gene in a family associated with hypertension.
12741817 2003 Identification of the residues in the helix F/G loop important to catalytic function of membrane-bound prostacyclin synthase.
12664597 2002 Effects of overexpression of prostacyclin synthase in vascular smooth muscle cells.
12562775 2003 Specific nitration at tyrosine 430 revealed by high resolution mass spectrometry as basis for redox regulation of bovine prostacyclin synthase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12428676 2002 Sequence analysis, frequency and ethnic distribution of VNTR polymorphism in the 5'-untranslated region of the human prostacyclin synthase gene (CYP8A1).
12414902 2002 Expression of prostaglandin I(2) synthase, but not prostaglandin E synthase, changes in myometrium of women at term pregnancy.
12414894 2002 Cyclic mechanical stretch augments prostacyclin production in cultured human uterine myometrial cells from pregnant women: possible involvement of up-regulation of prostacyclin synthase expression.
12372404 2002 Splicing mutation of the prostacyclin synthase gene in a family associated with hypertension.
12213900 2002 Human fallopian tubes express prostacyclin (PGI) synthase and cyclooxygenases and synthesize abundant PGI.
12193162 2002 Solution structure and topology of the N-terminal membrane anchor domain of a microsomal cytochrome P450: prostaglandin I2 synthase.
12040339 2002 Association of a novel single nucleotide polymorphism of the prostacyclin synthase gene with myocardial infarction.
11924728 2002 Association study between a novel single nucleotide polymorphism of the promoter region of the prostacyclin synthase gene and essential hypertension.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11551955 2001 Prostacyclin-dependent apoptosis mediated by PPAR delta.
11368458 2001 Polymorphism of the promoter region of prostacyclin synthase gene is not related to essential hypertension.
11339822 2001 Colocalization prostacyclin (PGI2) synthase--caveolin-1 in endothelial cells and new roles for PGI2 in angiogenesis.
11281454 2001 Characterization of new mutations in the coding sequence and 5'-untranslated region of the human prostacylcin synthase gene (CYP8A1).
11130769 2000 Association of 5' upstream promoter region of prostacyclin synthase gene variant with cerebral infarction.
9367522 1997 Nitric oxide modulates the activity of the hemoproteins prostaglandin I2 synthase and thromboxane A2 synthase.
8831668 1996 Organization of the gene encoding human prostacyclin synthase.
8812456 1996 Human gene encoding prostacyclin synthase (PTGIS): genomic organization, chromosomal localization, and promoter activity.
8630042 1996 Organization of the human prostacyclin synthase gene.
8185632 1994 Molecular cloning and expression of human prostacyclin synthase.